Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
tuberculosis 2010 2.1e-05
group 3 medulloblastoma 4104 2.6e-05
lung cancer 4740 3.6e-04
colon cancer 1478 6.5e-03
primitive neuroectodermal tumor 3035 3.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (5)

Disease log2 FC p
colon cancer 1.600 6.5e-03
group 3 medulloblastoma 2.100 2.6e-05
lung cancer 1.900 3.6e-04
primitive neuroectodermal tumor 1.300 3.1e-02
tuberculosis -1.300 2.1e-05

AA Sequence

MLQQLLITLPTEASTWVKLRHPKAATERVALWEDVTKMFKAEALLSQDADETQGESLESRVTLGSLTAES      1 - 70
QELLTFKDVSVDFTQEEWGQLAPAHRNLYREVMLENYGNLVSVGCQLSKPGVISQLEKGEEPWLMERDIS     71 - 140
GVPSSDLKSKTKTKESALQNDISWEELHCGLMMERFTKGSSMYSTLGRISKCNKLESQQENQRMGKGQIP    141 - 210
LMCKKTFTQERGQESNRFEKRINVKSEVMPGPIGLPRKRDRKYDTPGKRSRYNIDLVNHSRSYTKMKTFE    211 - 280
CNICEKIFKQLIHLTEHMRIHTGEKPFRCKECGKAFSQSSSLIPHQRIHTGEKPYECKECGKTFRHPSSL    281 - 350
TQHVRIHTGEKPYECRVCEKAFSQSIGLIQHLRTHVREKPFTCKDCGKAFFQIRHLRQHEIIHTGVKPYI    351 - 420
CNVCSKTFSHSTYLTQHQRTHTGERPYKCKECGKAFSQRIHLSIHQRVHTGVKPYECSHCGKAFRHDSSF    421 - 490
AKHQRIHTGEKPYDCNECGKAFSCSSSLIRHCKTHLRNTFSNVV                              491 - 534
//

Text Mined References (7)

PMID Year Title