Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
tuberculosis and treatment for 3 months 327 6.99653759979835E-6
group 3 medulloblastoma 2254 2.62648919386375E-5
lung cancer 4473 1.72693811113662E-4
colon cancer 1475 0.00647312526783936
primitive neuroectodermal tumor 3031 0.0305333105910049

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 2.100 0.000
primitive neuroectodermal tumor 1.300 0.031
tuberculosis and treatment for 3 months -1.400 0.000
lung cancer 2.400 0.000
colon cancer 1.600 0.006

Synonym

Accession Q9UJL9 Q5QPL4
Symbols ZNF643
ZSCAN54B
ZKSCAN23B

Gene

  Ortholog (2)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG

AA Sequence

MLQQLLITLPTEASTWVKLRHPKAATERVALWEDVTKMFKAEALLSQDADETQGESLESRVTLGSLTAES      1 - 70
QELLTFKDVSVDFTQEEWGQLAPAHRNLYREVMLENYGNLVSVGCQLSKPGVISQLEKGEEPWLMERDIS     71 - 140
GVPSSDLKSKTKTKESALQNDISWEELHCGLMMERFTKGSSMYSTLGRISKCNKLESQQENQRMGKGQIP    141 - 210
LMCKKTFTQERGQESNRFEKRINVKSEVMPGPIGLPRKRDRKYDTPGKRSRYNIDLVNHSRSYTKMKTFE    211 - 280
CNICEKIFKQLIHLTEHMRIHTGEKPFRCKECGKAFSQSSSLIPHQRIHTGEKPYECKECGKTFRHPSSL    281 - 350
TQHVRIHTGEKPYECRVCEKAFSQSIGLIQHLRTHVREKPFTCKDCGKAFFQIRHLRQHEIIHTGVKPYI    351 - 420
CNVCSKTFSHSTYLTQHQRTHTGERPYKCKECGKAFSQRIHLSIHQRVHTGVKPYECSHCGKAFRHDSSF    421 - 490
AKHQRIHTGEKPYDCNECGKAFSCSSSLIRHCKTHLRNTFSNVV                              491 - 534
//

Text Mined References (6)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.