Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.59
PubTator Score 0.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 1.34471238833351E-7
malignant mesothelioma 3163 6.90867751872238E-6
ovarian cancer 8492 4.3467918787611E-5
group 3 medulloblastoma 2254 4.92653350718816E-4
lung cancer 4473 8.47770153923655E-4
ulcerative colitis 2087 0.00142132715977471
colon cancer 1475 0.0206221703267748
spina bifida 1064 0.0474966032609159

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -1.100 0.000
lung cancer 2.100 0.001
colon cancer 1.100 0.021
group 3 medulloblastoma 1.300 0.000
posterior fossa group B ependymoma 1.400 0.000
spina bifida -1.171 0.047
ulcerative colitis -1.100 0.001
ovarian cancer -1.100 0.000

Synonym

Accession Q9UJG1 B2RE62 D3DTG5 Q5H9C5 Q5H9C7
Symbols DJ473B4

Gene

  Ortholog (15)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG

Gene RIF (1)

PMID Text
26175344 Our in vitro studies were supported by RNA-sequencing data that confirmed expression of Mospd1 mRNA in cultured, proliferating perivascular pre-MSCs isolated from human tissue

AA Sequence

MHQQKRQPELVEGNLPVFVFPTELIFYADDQSTHKQVLTLYNPYEFALKFKVLCTTPNKYVVVDAAGAVK      1 - 70
PQCCVDIVIRHRDVRSCHYGVIDKFRLQVSEQSQRKALGRKEVVATLLPSAKEQQKEEEEKRLKEHLTES     71 - 140
LFFEQSFQPENRAVSSGPSLLTVFLGVVCIAALMLPTLGDVESLVPLYLHLSVNQKLVAAYILGLITMAI    141 - 210
LRT                                                                       211 - 213
//

Text Mined References (7)

PMID Year Title
26175344 2015 A Role for MOSPD1 in Mesenchymal Stem Cell Proliferation and Differentiation.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15772651 2005 The DNA sequence of the human X chromosome.
15533722 2004 A novel transmembrane MSP-containing protein that plays a role in right ventricle development.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.