Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.59
PubTator Score 0.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -1.100 0.000
lung cancer 2.100 0.001
colon cancer 1.100 0.021
group 3 medulloblastoma 1.300 0.000
posterior fossa group B ependymoma 1.400 0.000
spina bifida -1.171 0.047
ulcerative colitis -1.100 0.001
ovarian cancer -1.100 0.000

Synonym

Accession Q9UJG1 B2RE62 D3DTG5 Q5H9C5 Q5H9C7
Symbols DJ473B4

Gene

Gene RIF (1)

PMID Text
26175344 Our in vitro studies were supported by RNA-sequencing data that confirmed expression of Mospd1 mRNA in cultured, proliferating perivascular pre-MSCs isolated from human tissue

AA Sequence

MHQQKRQPELVEGNLPVFVFPTELIFYADDQSTHKQVLTLYNPYEFALKFKVLCTTPNKYVVVDAAGAVK      1 - 70
PQCCVDIVIRHRDVRSCHYGVIDKFRLQVSEQSQRKALGRKEVVATLLPSAKEQQKEEEEKRLKEHLTES     71 - 140
LFFEQSFQPENRAVSSGPSLLTVFLGVVCIAALMLPTLGDVESLVPLYLHLSVNQKLVAAYILGLITMAI    141 - 210
LRT                                                                       211 - 213
//

Text Mined References (7)

PMID Year Title
26175344 2015 A Role for MOSPD1 in Mesenchymal Stem Cell Proliferation and Differentiation.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15772651 2005 The DNA sequence of the human X chromosome.
15533722 2004 A novel transmembrane MSP-containing protein that plays a role in right ventricle development.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.