Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.09
PubTator Score 0.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
colon cancer 1.100 2.1e-02
group 3 medulloblastoma 1.300 4.9e-04
lung cancer 2.100 8.5e-04
malignant mesothelioma -1.100 6.9e-06
ovarian cancer -1.100 4.3e-05
posterior fossa group B ependymoma 1.400 1.3e-07
spina bifida -1.171 4.7e-02
ulcerative colitis -1.100 1.4e-03

Gene RIF (2)

AA Sequence

MHQQKRQPELVEGNLPVFVFPTELIFYADDQSTHKQVLTLYNPYEFALKFKVLCTTPNKYVVVDAAGAVK      1 - 70
PQCCVDIVIRHRDVRSCHYGVIDKFRLQVSEQSQRKALGRKEVVATLLPSAKEQQKEEEEKRLKEHLTES     71 - 140
LFFEQSFQPENRAVSSGPSLLTVFLGVVCIAALMLPTLGDVESLVPLYLHLSVNQKLVAAYILGLITMAI    141 - 210
LRT                                                                       211 - 213
//

Text Mined References (8)

PMID Year Title