Property Summary

NCBI Gene PubMed Count 25
PubMed Score 28.61
PubTator Score 19.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
juvenile dermatomyositis 1189 9.22855039920958E-9
posterior fossa group B ependymoma 1530 2.13062764598016E-7
osteosarcoma 7933 6.34830655145465E-7
atypical teratoid / rhabdoid tumor 4369 1.34996752122699E-6
glioblastoma 5572 2.50163384032778E-5
pilocytic astrocytoma 3086 0.00119563168109323
medulloblastoma, large-cell 6234 0.00202503242459267
adult high grade glioma 2148 0.00301777536947276
medulloblastoma 1524 0.00715530801458351
pancreatic cancer 2300 0.0110295053937179
primary pancreatic ductal adenocarcinoma 1271 0.0127347409086513
esophageal adenocarcinoma 737 0.021244639288111
astrocytic glioma 2241 0.0226691029891812
progressive supranuclear palsy 674 0.0228180241813056
oligodendroglioma 2849 0.0305029518470711
spina bifida 1064 0.0313264450747945
subependymal giant cell astrocytoma 2287 0.049945351378786

Expression

Synonym

Accession Q9UJF2 F8W755 O95174 Q2TB22 Q5TFU9
Symbols NGAP

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (8)

PMID Text
25446096 the down-regulation of RASAL2 promotes metastatic progression of lung adenocarcinoma
25384218 these results indicate that activation of a RASAL2/ARHGAP24/RAC1 module contributes to TNBC tumorigenesis and identify a context-dependent role of RASAL2 in breast cancer.
25216515 Results implicate RASAL2 as an EMT regulator and tumor suppressor in ovarian cancer, and down-regulation of RASAL2 promotes ovarian cancer progression.
24763612 High RASAL2 expression is associated with liver cancer.
24029233 The RasGAP gene, RASAL2, is a tumor and metastasis suppressor.
22683310 RASAL2 was identified as an ECT2-interacting protein that regulates RHO activity in astrocytoma cells.
20816195 Observational study of gene-disease association. (HuGE Navigator)
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)

AA Sequence

MQTPEVPAERSPRRRSISGTSTSEKPNSMDTANTSPFKVPGFFSKRLKGSIKRTKSQSKLDRNTSFRLPS      1 - 70
LRSTDDRSRGLPKLKESRSHESLLSPCSTVECLDLGRGEPVSVKPLHSSILGQDFCFEVTYLSGSKCFSC     71 - 140
NSASERDKWMENLRRTVQPNKDNCRRAENVLRLWIIEAKDLAPKKKYFCELCLDDTLFARTTSKTKADNI    141 - 210
FWGEHFEFFSLPPLHSITVHIYKDVEKKKKKDKNNYVGLVNIPTASVTGRQFVEKWYPVSTPTPNKGKTG    211 - 280
GPSIRIKSRFQTITILPMEQYKEFAEFVTSNYTMLCSVLEPVISVRNKEELACALVHILQSTGRAKDFLT    281 - 350
DLVMSEVDRCGEHDVLIFRENTIATKSIEEYLKLVGQQYLHDALGEFIKALYESDENCEVDPSKCSSSEL    351 - 420
IDHQSNLKMCCELAFCKIINSYCVFPRELKEVFASWKQQCLNRGKQDISERLISASLFLRFLCPAIMSPS    421 - 490
LFNLMQEYPDDRTSRTLTLIAKVIQNLANFAKFGNKEEYMAFMNDFLEHEWGGMKRFLLEISNPDTISNT    491 - 560
PGFDGYIDLGRELSVLHSLLWEVVSQLDKGENSFLQATVAKLGPLPRVLADITKSLTNPTPIQQQLRRFT    561 - 630
EHNSSPNVSGSLSSGLQKIFEDPTDSDLHKLKSPSQDNTDSYFRGKTLLLVQQASSQSMTYSEKDERESS    631 - 700
LPNGRSVSLMDLQDTHAAQVEHASVMLDVPIRLTGSQLSITQVASIKQLRETQSTPQSAPQVRRPLHPAL    701 - 770
NQPGGLQPLSFQNPVYHLNNPIPAMPKASIDSSLENLSTASSRSQSNSEDFKLSGPSNSSMEDFTKRSTQ    771 - 840
SEDFSRRHTVPDRHIPLALPRQNSTGQAQIRKVDQGGLGARAKAPPSLPHSASLRSTGSMSVVSAALVAE    841 - 910
PVQNGSRSRQQSSSSRESPVPKVRAIQRQQTQQVQSPVDSATMSPVERTAAWVLNNGQYEEDVEETEQNL    911 - 980
DEAKHAEKYEQEITKLKERLRVSSRRLEEYERRLLVQEQQMQKLLLEYKARLEDSEERLRRQQEEKDSQM    981 - 1050
KSIISRLMAVEEELKKDHAEMQAVIDAKQKIIDAQEKRIVSLDSANTRLMSALTQVKERYSMQVRNGISP   1051 - 1120
TNPTKLSITENGEFKNSSC                                                      1121 - 1139
//

Text Mined References (34)

PMID Year Title
25446096 2014 RASAL2 promotes lung cancer metastasis through epithelial-mesenchymal transition.
25416956 2014 A proteome-scale map of the human interactome network.
25384218 2014 RASAL2 activates RAC1 to promote triple-negative breast cancer progression.
25216515 2014 RASAL2 down-regulation in ovarian cancer promotes epithelial-mesenchymal transition and metastasis.
24763612 2014 Genome-wide study of hypomethylated and induced genes in patients with liver cancer unravels novel anticancer targets.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24029233 2013 The RasGAP gene, RASAL2, is a tumor and metastasis suppressor.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22683310 2012 ECT2 and RASAL2 mediate mesenchymal-amoeboid transition in human astrocytoma cells.
More...