Property Summary

NCBI Gene PubMed Count 28
PubMed Score 32.99
PubTator Score 19.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.500 3.0e-03
astrocytic glioma -1.300 2.3e-02
Astrocytoma, Pilocytic -1.200 1.2e-03
atypical teratoid / rhabdoid tumor -2.100 1.3e-06
ependymoma -1.400 3.5e-02
esophageal adenocarcinoma -1.400 2.1e-02
glioblastoma -1.300 7.0e-06
group 3 medulloblastoma 1.100 1.9e-02
juvenile dermatomyositis 1.156 9.2e-09
medulloblastoma, large-cell -2.100 2.0e-03
oligodendroglioma -1.200 3.1e-02
osteosarcoma 1.510 8.9e-03
pancreatic cancer 1.200 1.1e-02
primary pancreatic ductal adenocarcinoma 1.227 1.3e-02
progressive supranuclear palsy 1.100 2.3e-02
spina bifida -1.672 3.1e-02
subependymal giant cell astrocytoma 1.044 5.0e-02

Gene RIF (11)

AA Sequence

MQTPEVPAERSPRRRSISGTSTSEKPNSMDTANTSPFKVPGFFSKRLKGSIKRTKSQSKLDRNTSFRLPS      1 - 70
LRSTDDRSRGLPKLKESRSHESLLSPCSTVECLDLGRGEPVSVKPLHSSILGQDFCFEVTYLSGSKCFSC     71 - 140
NSASERDKWMENLRRTVQPNKDNCRRAENVLRLWIIEAKDLAPKKKYFCELCLDDTLFARTTSKTKADNI    141 - 210
FWGEHFEFFSLPPLHSITVHIYKDVEKKKKKDKNNYVGLVNIPTASVTGRQFVEKWYPVSTPTPNKGKTG    211 - 280
GPSIRIKSRFQTITILPMEQYKEFAEFVTSNYTMLCSVLEPVISVRNKEELACALVHILQSTGRAKDFLT    281 - 350
DLVMSEVDRCGEHDVLIFRENTIATKSIEEYLKLVGQQYLHDALGEFIKALYESDENCEVDPSKCSSSEL    351 - 420
IDHQSNLKMCCELAFCKIINSYCVFPRELKEVFASWKQQCLNRGKQDISERLISASLFLRFLCPAIMSPS    421 - 490
LFNLMQEYPDDRTSRTLTLIAKVIQNLANFAKFGNKEEYMAFMNDFLEHEWGGMKRFLLEISNPDTISNT    491 - 560
PGFDGYIDLGRELSVLHSLLWEVVSQLDKGENSFLQATVAKLGPLPRVLADITKSLTNPTPIQQQLRRFT    561 - 630
EHNSSPNVSGSLSSGLQKIFEDPTDSDLHKLKSPSQDNTDSYFRGKTLLLVQQASSQSMTYSEKDERESS    631 - 700
LPNGRSVSLMDLQDTHAAQVEHASVMLDVPIRLTGSQLSITQVASIKQLRETQSTPQSAPQVRRPLHPAL    701 - 770
NQPGGLQPLSFQNPVYHLNNPIPAMPKASIDSSLENLSTASSRSQSNSEDFKLSGPSNSSMEDFTKRSTQ    771 - 840
SEDFSRRHTVPDRHIPLALPRQNSTGQAQIRKVDQGGLGARAKAPPSLPHSASLRSTGSMSVVSAALVAE    841 - 910
PVQNGSRSRQQSSSSRESPVPKVRAIQRQQTQQVQSPVDSATMSPVERTAAWVLNNGQYEEDVEETEQNL    911 - 980
DEAKHAEKYEQEITKLKERLRVSSRRLEEYERRLLVQEQQMQKLLLEYKARLEDSEERLRRQQEEKDSQM    981 - 1050
KSIISRLMAVEEELKKDHAEMQAVIDAKQKIIDAQEKRIVSLDSANTRLMSALTQVKERYSMQVRNGISP   1051 - 1120
TNPTKLSITENGEFKNSSC                                                      1121 - 1139
//

Text Mined References (37)

PMID Year Title