Property Summary

NCBI Gene PubMed Count 25
Grant Count 6
R01 Count 4
Funding $348,298.32
PubMed Score 28.61
PubTator Score 19.50

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (11)

Gene RIF (8)

PMID Text
25446096 the down-regulation of RASAL2 promotes metastatic progression of lung adenocarcinoma
25384218 these results indicate that activation of a RASAL2/ARHGAP24/RAC1 module contributes to TNBC tumorigenesis and identify a context-dependent role of RASAL2 in breast cancer.
25216515 Results implicate RASAL2 as an EMT regulator and tumor suppressor in ovarian cancer, and down-regulation of RASAL2 promotes ovarian cancer progression.
24763612 High RASAL2 expression is associated with liver cancer.
24029233 The RasGAP gene, RASAL2, is a tumor and metastasis suppressor.
22683310 RASAL2 was identified as an ECT2-interacting protein that regulates RHO activity in astrocytoma cells.
20816195 Observational study of gene-disease association. (HuGE Navigator)
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)

AA Sequence

MQTPEVPAERSPRRRSISGTSTSEKPNSMDTANTSPFKVPGFFSKRLKGSIKRTKSQSKLDRNTSFRLPS      1 - 70
LRSTDDRSRGLPKLKESRSHESLLSPCSTVECLDLGRGEPVSVKPLHSSILGQDFCFEVTYLSGSKCFSC     71 - 140
NSASERDKWMENLRRTVQPNKDNCRRAENVLRLWIIEAKDLAPKKKYFCELCLDDTLFARTTSKTKADNI    141 - 210
FWGEHFEFFSLPPLHSITVHIYKDVEKKKKKDKNNYVGLVNIPTASVTGRQFVEKWYPVSTPTPNKGKTG    211 - 280
GPSIRIKSRFQTITILPMEQYKEFAEFVTSNYTMLCSVLEPVISVRNKEELACALVHILQSTGRAKDFLT    281 - 350
DLVMSEVDRCGEHDVLIFRENTIATKSIEEYLKLVGQQYLHDALGEFIKALYESDENCEVDPSKCSSSEL    351 - 420
IDHQSNLKMCCELAFCKIINSYCVFPRELKEVFASWKQQCLNRGKQDISERLISASLFLRFLCPAIMSPS    421 - 490
LFNLMQEYPDDRTSRTLTLIAKVIQNLANFAKFGNKEEYMAFMNDFLEHEWGGMKRFLLEISNPDTISNT    491 - 560
PGFDGYIDLGRELSVLHSLLWEVVSQLDKGENSFLQATVAKLGPLPRVLADITKSLTNPTPIQQQLRRFT    561 - 630
EHNSSPNVSGSLSSGLQKIFEDPTDSDLHKLKSPSQDNTDSYFRGKTLLLVQQASSQSMTYSEKDERESS    631 - 700
LPNGRSVSLMDLQDTHAAQVEHASVMLDVPIRLTGSQLSITQVASIKQLRETQSTPQSAPQVRRPLHPAL    701 - 770
NQPGGLQPLSFQNPVYHLNNPIPAMPKASIDSSLENLSTASSRSQSNSEDFKLSGPSNSSMEDFTKRSTQ    771 - 840
SEDFSRRHTVPDRHIPLALPRQNSTGQAQIRKVDQGGLGARAKAPPSLPHSASLRSTGSMSVVSAALVAE    841 - 910
PVQNGSRSRQQSSSSRESPVPKVRAIQRQQTQQVQSPVDSATMSPVERTAAWVLNNGQYEEDVEETEQNL    911 - 980
DEAKHAEKYEQEITKLKERLRVSSRRLEEYERRLLVQEQQMQKLLLEYKARLEDSEERLRRQQEEKDSQM    981 - 1050
KSIISRLMAVEEELKKDHAEMQAVIDAKQKIIDAQEKRIVSLDSANTRLMSALTQVKERYSMQVRNGISP   1051 - 1120
TNPTKLSITENGEFKNSSC                                                      1121 - 1139
//

Publication (34)

PMID Year Title
25446096 2014 RASAL2 promotes lung cancer metastasis through epithelial-mesenchymal transition.
25416956 2014 A proteome-scale map of the human interactome network.
25384218 2014 RASAL2 activates RAC1 to promote triple-negative breast cancer progression.
25216515 2014 RASAL2 down-regulation in ovarian cancer promotes epithelial-mesenchymal transition and metastasis.
24763612 2014 Genome-wide study of hypomethylated and induced genes in patients with liver cancer unravels novel anticancer targets.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24029233 2013 The RasGAP gene, RASAL2, is a tumor and metastasis suppressor.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22683310 2012 ECT2 and RASAL2 mediate mesenchymal-amoeboid transition in human astrocytoma cells.
More...