Property Summary

NCBI Gene PubMed Count 13
PubMed Score 18.90
PubTator Score 8.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma -3.500 2.2e-08
astrocytic glioma -2.400 3.9e-03
Astrocytoma, Pilocytic -3.800 5.2e-12
atypical teratoid / rhabdoid tumor -3.800 1.4e-10
Breast cancer -1.100 4.3e-05
cystic fibrosis -1.698 8.2e-06
ependymoma -4.000 1.2e-03
glioblastoma -3.400 5.8e-11
group 3 medulloblastoma -1.900 1.6e-04
intraductal papillary-mucinous adenoma (... 1.500 1.1e-02
lung cancer -1.300 2.0e-02
malignant mesothelioma 1.700 5.3e-05
medulloblastoma, large-cell -3.200 1.7e-05
oligodendroglioma -2.500 2.9e-02
osteosarcoma -2.603 7.8e-05
ovarian cancer -1.200 8.3e-08
pituitary cancer 1.800 1.4e-03
primitive neuroectodermal tumor -2.300 3.2e-04
psoriasis 1.500 7.8e-04
subependymal giant cell astrocytoma -4.309 1.2e-02

Gene RIF (3)

AA Sequence

MFNGEPGPASSGASRNVVRSSSISGEICGSQQAGGGAGTTTAKKRRSSLGAKMVAIVGLTQWSKSTLQLP      1 - 70
QPEGATKKLRSNIRRSTETGIAVEMRSRVTRQGSRESTDGSTNSNSSDGTFIFPTTRLGAESQFSDFLDG     71 - 140
LGPAQIVGRQTLATPPMGDVHIAIMDRSGQLEVEVIEARGLTPKPGSKSLPATYIKVYLLENGACLAKKK    141 - 210
TKMTKKTCDPLYQQALLFDEGPQGKVLQVIVWGDYGRMDHKCFMGMAQIMLDELDLSAAVTGWYKLFPTS    211 - 280
SVADSTLGSLTRRLSQSSLESATSPSCS                                              281 - 308
//

Text Mined References (14)

PMID Year Title