Property Summary

NCBI Gene PubMed Count 12
PubMed Score 14.90
PubTator Score 8.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
malignant mesothelioma 1.700 0.000
astrocytoma -3.000 0.005
ependymoma -4.000 0.001
oligodendroglioma -2.500 0.029
psoriasis 1.900 0.000
glioblastoma -4.000 0.000
osteosarcoma -2.603 0.000
group 4 medulloblastoma -3.300 0.000
cystic fibrosis -1.698 0.000
atypical teratoid / rhabdoid tumor -3.800 0.000
medulloblastoma, large-cell -3.200 0.000
primitive neuroectodermal tumor -2.300 0.000
intraductal papillary-mucinous adenoma (... 1.500 0.011
lung cancer -1.800 0.000
pediatric high grade glioma -3.500 0.000
pilocytic astrocytoma -3.700 0.000
subependymal giant cell astrocytoma -4.309 0.012
non-inflammatory breast cancer -1.100 0.002
ovarian cancer -1.200 0.000
pituitary cancer 1.800 0.001

Gene RIF (2)

PMID Text
19546099 Observational study of gene-disease association. (HuGE Navigator)
18490030 Western blot analysis shows increased piccolo protein expression in the amygdala in schizophrenia.

AA Sequence

MFNGEPGPASSGASRNVVRSSSISGEICGSQQAGGGAGTTTAKKRRSSLGAKMVAIVGLTQWSKSTLQLP      1 - 70
QPEGATKKLRSNIRRSTETGIAVEMRSRVTRQGSRESTDGSTNSNSSDGTFIFPTTRLGAESQFSDFLDG     71 - 140
LGPAQIVGRQTLATPPMGDVHIAIMDRSGQLEVEVIEARGLTPKPGSKSLPATYIKVYLLENGACLAKKK    141 - 210
TKMTKKTCDPLYQQALLFDEGPQGKVLQVIVWGDYGRMDHKCFMGMAQIMLDELDLSAAVTGWYKLFPTS    211 - 280
SVADSTLGSLTRRLSQSSLESATSPSCS                                              281 - 308
//

Text Mined References (13)

PMID Year Title
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
19546099 2010 A de novo 1p34.2 microdeletion identifies the synaptic vesicle gene RIMS3 as a novel candidate for autism.
18490030 2009 Investigation of the expression of genes affecting cytomatrix active zone function in the amygdala in schizophrenia: effects of antipsychotic drugs.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15217342 2004 The synaptic vesicle cycle.
12620390 2003 Genomic definition of RIM proteins: evolutionary amplification of a family of synaptic regulatory proteins.
More...