Property Summary

NCBI Gene PubMed Count 8
PubMed Score 9.06
PubTator Score 4.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
psoriasis -2.600 0.000
medulloblastoma, large-cell -1.200 0.005
primitive neuroectodermal tumor 1.100 0.001
pancreatic ductal adenocarcinoma liver m... 1.051 0.023
lung cancer -1.400 0.004
aldosterone-producing adenoma -1.124 0.031
Pick disease 1.200 0.000
gastric carcinoma 1.500 0.011
ovarian cancer -1.200 0.000

Synonym

Accession Q9UJ78 B2R6V1 Q5T6E1 Q5T6E2 Q5T6E4 Q96IY6 Q9NZY5 Q9UBW0 Q9UJ77
Symbols MYM
ZNF237
HSPC050
ZNF198L1

Gene

PANTHER Protein Class (1)

PDB

2DAS  

AA Sequence

MEKCSVGGLELTEQTPALLGNMAMATSLMDIGDSFGHPACPLVSRSRNSPVEDDDDDDDVVFIESIQPPS      1 - 70
ISAPAIADQRNFIFASSKNEKPQGNYSVIPPSSRDLASQKGNISETIVIDDEEDIETNGGAEKKSSCFIE     71 - 140
WGLPGTKNKTNDLDFSTSSLSRSKTKTGVRPFNPGRMNVAGDLFQNGEFATHHSPDSWISQSASFPSNQK    141 - 210
QPGVDSLSPVALLRKQNFQPTAQQQLTKPAKITCANCKKPLQKGQTAYQRKGSAHLFCSTTCLSSFSHKR    211 - 280
TQNTRSIICKKDASTKKANVILPVESSKSFQEFYSTSCLSPCENNWNLKKGVFNKSRCTICSKLAEIRHE    281 - 350
VSVNNVTHKLCSNHCFNKYRLANGLIMNCCEHCGEYMPSKSTGNNILVIGGQQKRFCCQSCINEYKQMME    351 - 420
TKSKKLTASENRKRNAFREENEKQLYGSSNTLLKKIEGIPEKKEKTSQLQLSVECGTDTLLIQENVNLPP    421 - 490
SSTSTIADTFQEQLEEKNFEDSIVPVVLSADPGTWPRILNIKQRDTLVENVPPQVRNFNFPKDNTGRKFS    491 - 560
ETYYTRILPNGEKTTRSWLLYSTSKDSVFCLYCKLFGEGKNQLKNENGCKDWQHLSHILSKHEESEMHVN    561 - 630
NSVKYSKLKSDLKKNKAIDAAEHRLYENEKNDGVLLLYT                                   631 - 669
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
20036849 2010 Transcriptional regulation of the presenilin-1 gene controls gamma-secretase activity.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
17126306 2007 Analysis of transcriptional modulation of the presenilin 1 gene promoter by ZNF237, a candidate binding partner of the Ets transcription factor ERM.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
More...