Property Summary

NCBI Gene PubMed Count 8
PubMed Score 9.06
PubTator Score 4.07

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
aldosterone-producing adenoma -1.124 3.1e-02
gastric carcinoma 1.500 1.1e-02
lung cancer -1.400 3.8e-03
malignant mesothelioma 1.100 2.8e-06
medulloblastoma, large-cell -1.200 4.6e-03
ovarian cancer -1.200 2.0e-06
pancreatic ductal adenocarcinoma liver m... 1.051 2.3e-02
Pick disease 1.200 4.7e-06
primitive neuroectodermal tumor 1.100 7.9e-04
psoriasis -2.600 6.4e-05

AA Sequence

MEKCSVGGLELTEQTPALLGNMAMATSLMDIGDSFGHPACPLVSRSRNSPVEDDDDDDDVVFIESIQPPS      1 - 70
ISAPAIADQRNFIFASSKNEKPQGNYSVIPPSSRDLASQKGNISETIVIDDEEDIETNGGAEKKSSCFIE     71 - 140
WGLPGTKNKTNDLDFSTSSLSRSKTKTGVRPFNPGRMNVAGDLFQNGEFATHHSPDSWISQSASFPSNQK    141 - 210
QPGVDSLSPVALLRKQNFQPTAQQQLTKPAKITCANCKKPLQKGQTAYQRKGSAHLFCSTTCLSSFSHKR    211 - 280
TQNTRSIICKKDASTKKANVILPVESSKSFQEFYSTSCLSPCENNWNLKKGVFNKSRCTICSKLAEIRHE    281 - 350
VSVNNVTHKLCSNHCFNKYRLANGLIMNCCEHCGEYMPSKSTGNNILVIGGQQKRFCCQSCINEYKQMME    351 - 420
TKSKKLTASENRKRNAFREENEKQLYGSSNTLLKKIEGIPEKKEKTSQLQLSVECGTDTLLIQENVNLPP    421 - 490
SSTSTIADTFQEQLEEKNFEDSIVPVVLSADPGTWPRILNIKQRDTLVENVPPQVRNFNFPKDNTGRKFS    491 - 560
ETYYTRILPNGEKTTRSWLLYSTSKDSVFCLYCKLFGEGKNQLKNENGCKDWQHLSHILSKHEESEMHVN    561 - 630
NSVKYSKLKSDLKKNKAIDAAEHRLYENEKNDGVLLLYT                                   631 - 669
//

Text Mined References (12)

PMID Year Title