Property Summary

NCBI Gene PubMed Count 24
PubMed Score 25.33
PubTator Score 25.31

Knowledge Summary

Patent

No data available

Expression

Gene RIF (15)

AA Sequence

MFCGDYVQGTIFPAPNFNPIMDAQMLGGALQGFDCDKDMLINILTQRCNAQRMMIAEAYQSMYGRDLIGD      1 - 70
MREQLSDHFKDVMAGLMYPPPLYDAHELWHAMKGVGTDENCLIEILASRTNGEIFQMREAYCLQYSNNLQ     71 - 140
EDIYSETSGHFRDTLMNLVQGTREEGYTDPAMAAQDAMVLWEACQQKTGEHKTMLQMILCNKSYQQLRLV    141 - 210
FQEFQNISGQDMVDAINECYDGYFQELLVAIVLCVRDKPAYFAYRLYSAIHDFGFHNKTVIRILIARSEI    211 - 280
DLLTIRKRYKERYGKSLFHDIRNFASGHYKKALLAICAGDAEDY                              281 - 324
//

Text Mined References (24)

PMID Year Title