Property Summary

NCBI Gene PubMed Count 22
PubMed Score 23.72
PubTator Score 25.31

Knowledge Summary

Patent

No data available

Expression

Gene RIF (13)

PMID Text
26361422 Annexin A10 expression is associated with poor clinical behavior and can be used a supportive surrogate marker of the serrated neoplasia pathway in invasive colorectal carcinomas.
25395067 there is a correlation between high ANXA10 expression and serrated growth pattern in colorectal carcinoma
25081749 Our results indicated that ANXA10 expression is implicated in gastric programming in serrated-pathway-associated colorectal carcinoma.
24909058 ANXA10+ MSI-H colon carcinomas are characterized by serrated pathway features, including proximal location, female predominance, and high frequencies of CIMP-H status and MLH1 methylation.
24625416 immunohistochemistry for annexin A10 may be a useful marker to distinguish sporadic from Lynch syndrome-associated microsatellite-unstable colon cancer
24024557 Our study results indicate that the inclusion of ANXA10 in an immunohistochemical panel will be helpful in the differential diagnosis of adenocarcinoma of an unknown primary site.
23715859 Overexpression of annexin A10 increases their sensitivity to apoptosis and reduces colony formation.
23073794 The apoptosis rate in PGC-Fu-ANXA10 group was significantly higher than in PGC-Fu group.
23029062 ANXA10 is an indicator of cellular proliferation in OSCCs. Our results suggested that ANXA10 expression might indicate cellular proliferation and ANXA10 might be a potential therapeutic target for the development of new treatments for OSCCs.
21979422 We conclude that ANXA10 may be a clinical relevant marker for predicting outcome in both early and advanced stages of bladder cancer.
More...

AA Sequence

MFCGDYVQGTIFPAPNFNPIMDAQMLGGALQGFDCDKDMLINILTQRCNAQRMMIAEAYQSMYGRDLIGD      1 - 70
MREQLSDHFKDVMAGLMYPPPLYDAHELWHAMKGVGTDENCLIEILASRTNGEIFQMREAYCLQYSNNLQ     71 - 140
EDIYSETSGHFRDTLMNLVQGTREEGYTDPAMAAQDAMVLWEACQQKTGEHKTMLQMILCNKSYQQLRLV    141 - 210
FQEFQNISGQDMVDAINECYDGYFQELLVAIVLCVRDKPAYFAYRLYSAIHDFGFHNKTVIRILIARSEI    211 - 280
DLLTIRKRYKERYGKSLFHDIRNFASGHYKKALLAICAGDAEDY                              281 - 324
//

Text Mined References (22)

PMID Year Title
26361422 2015 Annexin A10 expression in colorectal cancers with emphasis on the serrated neoplasia pathway.
25416956 2014 A proteome-scale map of the human interactome network.
25395067 2015 Annexin A10 is a marker for the serrated pathway of colorectal carcinoma.
25081749 2015 Aberrant expression of annexin A10 is closely related to gastric phenotype in serrated pathway to colorectal carcinoma.
24909058 2014 Annexin A10 expression correlates with serrated pathway features in colorectal carcinoma with microsatellite instability.
24625416 2014 Immunohistochemistry for annexin A10 can distinguish sporadic from Lynch syndrome-associated microsatellite-unstable colorectal carcinoma.
24024557 2013 Annexin A10 is an immunohistochemical marker for adenocarcinoma of the upper gastrointestinal tract and pancreatobiliary system.
23715859 2014 The tumor suppressor annexin A10 is a novel component of nuclear paraspeckles.
23073794 2012 Effects of over-expression of ANXA10 gene on proliferation and apoptosis of hepatocellular carcinoma cell line HepG2.
23029062 2012 Annexin A10 in human oral cancer: biomarker for tumoral growth via G1/S transition by targeting MAPK signaling pathways.
More...