Property Summary

NCBI Gene PubMed Count 23
PubMed Score 41.94
PubTator Score 18.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytoma 1.300 4.7e-03
esophageal adenocarcinoma -1.600 1.8e-02
glioblastoma 1.400 9.1e-04
juvenile dermatomyositis 1.160 8.0e-11
malignant mesothelioma -1.100 1.5e-05
ovarian cancer -1.300 1.5e-06
psoriasis 1.100 4.9e-04

 GWAS Trait (1)

Gene RIF (5)

AA Sequence

MAAIYGGVEGGGTRSEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLRS      1 - 70
LGLSLSGGDQEDAGRILIEELRDRFPYLSESYLITTDAAGSIATATPDGGVVLISGTGSNCRLINPDGSE     71 - 140
SGCGGWGHMMGDEGSAYWIAHQAVKIVFDSIDNLEAAPHDIGYVKQAMFHYFQVPDRLGILTHLYRDFDK    141 - 210
CRFAGFCRKIAEGAQQGDPLSRYIFRKAGEMLGRHIVAVLPEIDPVLFQGKIGLPILCVGSVWKSWELLK    211 - 280
EGFLLALTQGREIQAQNFFSSFTLMKLRHSSALGGASLGARHIGHLLPMDYSANAIAFYSYTFS          281 - 344
//

Text Mined References (31)

PMID Year Title