Property Summary

NCBI Gene PubMed Count 15
Grant Count 2
Funding $400,128
PubMed Score 47.39
PubTator Score 20.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
posterior fossa group B ependymoma 3.000 0.000
cutaneous lupus erythematosus -1.100 0.018
psoriasis -1.300 0.000
osteosarcoma -1.626 0.032
atypical teratoid / rhabdoid tumor 1.400 0.000
glioblastoma 1.300 0.000
medulloblastoma, large-cell 1.400 0.000
tuberculosis and treatment for 6 months -1.300 0.000
lung cancer -3.100 0.000
diabetes mellitus -1.100 0.003
interstitial cystitis -1.700 0.000
lung adenocarcinoma -1.700 0.000
lung carcinoma -3.300 0.000
ovarian cancer 1.500 0.011

Synonym

Accession Q9UJ37 Q12971
Symbols STHM
SIAT7
SAITL1
SIAT7B
SIATL1
ST6GalNAII

Gene

PANTHER Protein Class (2)

 Grant Application (2)

Protein-protein Interaction (13)

Gene RIF (11)

PMID Text
24961352 ST6GalNAc II might be participated in the glycosylation of Axl, and this Axl glycosylation may mediate the tumorigenicity, invasion, and distant metastasis of breast phyllodes tumor cells.
24756995 High expression level of ST6GalNAcII is associated with invasive phenotype of breast cancer.
24520024 Results identified the sialyltransferase ST6GalNAc2 as a novel breast cancer metastasis suppressor.
24398680 Il-6 and Il-4 reduced galactosylation of the O-glycan substrate directly via decreased expression of the galactosyltransferase C1GalT1 and, indirectly, via increased expression of the sialyltransferase ST6GalNAc-II
23548905 ST6GalNAc2 is a novel enzyme that regulates leukocyte adhesion under fluid shear
19357720 potential genetic interactions of C1GALT1 and ST6GALNAC2 variants influence IgA1 O-glycosylation, disease predisposition, and disease severity, and may contribute to the polygenic nature of IgA nephropathy
19357720 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19170967 reduced sialylation of serum IgA1 may result from decreased expression of ST6GALNAC2.
17480010 Observational study of gene-disease association. (HuGE Navigator)
17480010 the ADG haplotype in the ST6GALNAC2 gene is a functional regulatory variant that may contribute to the genetic susceptibility in a subset of patients in whom the desialylation of IgA1 molecules was the main causative pathogenesis of IgAN
More...

AA Sequence

MGLPRGSFFWLLLLLTAACSGLLFALYFSAVQRYPGPAAGARDTTSFEAFFQSKASNSWTGKGQACRHLL      1 - 70
HLAIQRHPHFRGLFNLSIPVLLWGDLFTPALWDRLSQHKAPYGWRGLSHQVIASTLSLLNGSESAKLFAP     71 - 140
PRDTPPKCIRCAVVGNGGILNGSRQGPNIDAHDYVFRLNGAVIKGFERDVGTKTSFYGFTVNTMKNSLVS    141 - 210
YWNLGFTSVPQGQDLQYIFIPSDIRDYVMLRSAILGVPVPEGLDKGDRPHAYFGPEASASKFKLLHPDFI    211 - 280
SYLTERFLKSKLINTHFGDLYMPSTGALMLLTALHTCDQVSAYGFITSNYWKFSDHYFERKMKPLIFYAN    281 - 350
HDLSLEAALWRDLHKAGILQLYQR                                                  351 - 374
//

Publication (15)

PMID Year Title
24961352 2014 Phyllodes tumor of the breast: role of Axl and ST6GalNAcII in the development of mammary phyllodes tumors.
24756995 2014 ST6GalNAcII mediates the invasive properties of breast carcinoma through PI3K/Akt/NF-?B signaling pathway.
24520024 2014 An in vivo functional screen identifies ST6GalNAc2 sialyltransferase as a breast cancer metastasis suppressor.
24398680 2014 Cytokines alter IgA1 O-glycosylation by dysregulating C1GalT1 and ST6GalNAc-II enzymes.
23548905 2013 Competition between core-2 GlcNAc-transferase and ST6GalNAc-transferase regulates the synthesis of the leukocyte selectin ligand on human P-selectin glycoprotein ligand-1.
19357720 2009 Interaction between variants of two glycosyltransferase genes in IgA nephropathy.
19170967 2009 Activity of alpha2,6-sialyltransferase and its gene expression in peripheral B lymphocytes in patients with IgA nephropathy.
17480010 2007 Variants of the ST6GALNAC2 promoter influence transcriptional activity and contribute to genetic susceptibility to IgA nephropathy.
17418236 2007 Identification and characterization of CMP-NeuAc:GalNAc-IgA1 alpha2,6-sialyltransferase in IgA1-producing cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...