Property Summary

NCBI Gene PubMed Count 19
PubMed Score 55.63
PubTator Score 20.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Glomerulonephritis, IGA 34 0.0 0.0
Disease Target Count
IGA Glomerulonephritis 50
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (14)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.400 3.8e-05
cutaneous lupus erythematosus -1.100 1.8e-02
diabetes mellitus -1.100 3.4e-03
ependymoma 2.500 4.4e-02
glioblastoma 1.300 2.8e-05
interstitial cystitis -1.400 3.2e-04
lung adenocarcinoma -1.300 3.3e-07
lung cancer -1.900 7.5e-03
lung carcinoma -3.300 1.1e-27
medulloblastoma, large-cell 1.400 2.3e-05
osteosarcoma -1.626 3.2e-02
ovarian cancer 1.500 1.1e-02
psoriasis -1.300 3.3e-04
tuberculosis -1.100 7.4e-04

Gene RIF (15)

AA Sequence

MGLPRGSFFWLLLLLTAACSGLLFALYFSAVQRYPGPAAGARDTTSFEAFFQSKASNSWTGKGQACRHLL      1 - 70
HLAIQRHPHFRGLFNLSIPVLLWGDLFTPALWDRLSQHKAPYGWRGLSHQVIASTLSLLNGSESAKLFAP     71 - 140
PRDTPPKCIRCAVVGNGGILNGSRQGPNIDAHDYVFRLNGAVIKGFERDVGTKTSFYGFTVNTMKNSLVS    141 - 210
YWNLGFTSVPQGQDLQYIFIPSDIRDYVMLRSAILGVPVPEGLDKGDRPHAYFGPEASASKFKLLHPDFI    211 - 280
SYLTERFLKSKLINTHFGDLYMPSTGALMLLTALHTCDQVSAYGFITSNYWKFSDHYFERKMKPLIFYAN    281 - 350
HDLSLEAALWRDLHKAGILQLYQR                                                  351 - 374
//

Text Mined References (19)

PMID Year Title