Property Summary

NCBI Gene PubMed Count 53
Grant Count 4
Funding $252,462
PubMed Score 13.54
PubTator Score 15.95

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9UIV1 A8MZM5 B3KMP1 B3KN35 D3DSP6 G3V108 Q7Z530
Symbols CAF1
CAF-1
Caf1a
hCAF-1

Gene

PANTHER Protein Class (1)

PDB

4GMJ   2D5R  

Gene RIF (9)

PMID Text
26471122 MEX3C associates with the cytoplasmic deadenylation complexes and ubiquitinates CNOT7.
25038453 CNOT7/hCAF1 is involved in ICAM-1 and IL-8 regulation by TTP in HPMEC.
23386060 CNOT7 is an antimicrobial protein and a regulator of the innate immune response.
23236473 The anti-proliferative activity of BTG/TOB proteins is mediated via the Caf1a (CNOT7) and Caf1b (CNOT8) deadenylase subunits of the Ccr4-not complex.
19605561 Data show that efficient cell proliferation requires both CNOT7 and CNOT8, although combined knockdown of both subunits further reduces cell proliferation indicating partial redundancy between these proteins.
19558367 Data show that Ccr4-Not function in RNA splicing and nuclear export, and that CNOT7 binds strongly with CNOT6.
18084094 antiproliferative region of human Tob (residues 1-138) and intact hCaf1 were co-expressed in Escherichia coli, purified and successfully cocrystallized
17264152 CAF1 is a new regulator of PRMT1-dependent arginine methylation.
12845644 CNOT7 is not the target tumor suppressor gene in the 8p22-23.1 colorectal cancer suppressor region.

AA Sequence

MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVD      1 - 70
LLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELL     71 - 140
MTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQ    141 - 210
EVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEE    211 - 280
ANKQS                                                                     281 - 285
//

Text Mined References (57)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
27037025 2016 The CCR4-NOT deadenylase activity contributes to generation of induced pluripotent stem cells.
27013054 2016 Structural basis for inhibition of the deadenylase activity of human CNOT6L.
26541675 2015 Poly(A)-specific ribonuclease and Nocturnin in squamous cell lung cancer: prognostic value and impact on gene expression.
26518565 2015 Structural basis for inhibition of the Tob-CNOT7 interaction by a fragment screening approach.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26471122 2015 A non-proteolytic role for ubiquitin in deadenylation of MHC-I mRNA by the RNA-binding E3-ligase MEX-3C.
26299350 2015 Discovery, synthesis and biochemical profiling of purine-2,6-dione derivatives as inhibitors of the human poly(A)-selective ribonuclease Caf1.
26135631 2015 Cantharidin represses invasion of pancreatic cancer cells through accelerated degradation of MMP2 mRNA.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
More...