Property Summary

Ligand Count 1
NCBI Gene PubMed Count 55
PubMed Score 15.49
PubTator Score 15.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma 1.700 5.3e-03
Breast cancer -1.400 3.8e-03
ependymoma 1.800 5.7e-03
group 3 medulloblastoma 1.400 1.7e-02
intraductal papillary-mucinous adenoma (... 1.200 5.7e-03
intraductal papillary-mucinous carcinoma... 1.100 3.1e-02
Multiple myeloma 1.430 1.6e-03
oligodendroglioma 1.900 7.0e-04
osteosarcoma 1.579 3.0e-03
ovarian cancer -1.400 1.9e-04
primitive neuroectodermal tumor 1.600 3.8e-04
psoriasis -1.100 2.5e-04
tuberculosis and treatment for 3 months 1.300 2.3e-04
Waldenstrons macroglobulinemia 1.034 2.7e-02

Gene RIF (10)

AA Sequence

MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVD      1 - 70
LLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELL     71 - 140
MTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQ    141 - 210
EVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEE    211 - 280
ANKQS                                                                     281 - 285
//

Text Mined References (59)

PMID Year Title