Property Summary

NCBI Gene PubMed Count 6
PubMed Score 197.83
PubTator Score 85.56

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer 1.300 8.6e-05
chronic rhinosinusitis -1.050 2.9e-02
ductal carcinoma in situ 1.300 1.8e-04
invasive ductal carcinoma 1.900 7.0e-05
lung adenocarcinoma 1.600 4.5e-08
non-small cell lung cancer 2.087 1.0e-22
osteosarcoma 1.769 2.0e-03
ovarian cancer 1.600 3.9e-04

 GO Component (2)

 GWAS Trait (1)

Gene RIF (1)

AA Sequence

MSSSSPTGQIASAADIKQENGMESASEGQEAHREVAGGAAVGLSPPAPAPFPLEPGDAATAAARVSGEEG      1 - 70
AVAAAAAGAAADQVQLHSELLGRHHHAAAAAAQTPLAFSPDHVACVCEALQQGGNLDRLARFLWSLPQSD     71 - 140
LLRGNESLLKARALVAFHQGIYPELYSILESHSFESANHPLLQQLWYKARYTEAERARGRPLGAVDKYRL    141 - 210
RRKFPLPRTIWDGEETVYCFKEKSRNALKELYKQNRYPSPAEKRHLAKITGLSLTQVSNWFKNRRQRDRN    211 - 280
PSETQSKSESDGNPSTEDESSKGHEDLSPHPLSSSSDGITNLSLSSHMEPVYMQQIGNAKISLSSSGVLL    281 - 350
NGSLVPASTSPVFLNGNSFIQGPSGVILNGLNVGNTQAVALNPPKMSSNIVSNGISMTDILGSTSQDVKE    351 - 420
FKVLQSSANSATTTSYSPSVPVSFPGLIPSTEVKREGIQTVASQDGGSVVTFTTPVQINQYGIVQIPNSG    421 - 490
ANSQFLNGSIGFSPLQLPPVSVAASQGNISVSSSTSDGSTFTSESTTVQQGKVFLSSLAPSAVVYTVPNT    491 - 560
GQTIGSVKQEGLERSLVFSQLMPVNQNAQVNANLSSENISGSGLHPLASSLVNVSPTHNFSLSPSTLLNP    561 - 630
TELNRDIADSQPMSAPVASKSTVTSVSNTNYATLQNCSLITGQDLLSVPMTQAALGEIVPTAEDQVGHPS    631 - 700
PAVHQDFVQEHRLVLQSVANMKENFLSNSESKATSSLMMLDSKSKYVLDGMVDTVCEDLETDKKELAKLQ    701 - 770
TVQLDEDMQDL                                                               771 - 781
//

Text Mined References (11)

PMID Year Title