Property Summary

NCBI Gene PubMed Count 5
Grant Count 22
R01 Count 9
Funding $1,747,133.77
PubMed Score 182.90
PubTator Score 85.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma 1.769 0.002
non-small cell lung cancer 2.087 0.000
lung adenocarcinoma 1.600 0.000
Breast cancer 1.300 0.000
ductal carcinoma in situ 1.300 0.000
invasive ductal carcinoma 1.900 0.000
ovarian cancer 1.600 0.000
chronic rhinosinusitis -1.050 0.029

 GO Component (2)

AA Sequence

MSSSSPTGQIASAADIKQENGMESASEGQEAHREVAGGAAVGLSPPAPAPFPLEPGDAATAAARVSGEEG      1 - 70
AVAAAAAGAAADQVQLHSELLGRHHHAAAAAAQTPLAFSPDHVACVCEALQQGGNLDRLARFLWSLPQSD     71 - 140
LLRGNESLLKARALVAFHQGIYPELYSILESHSFESANHPLLQQLWYKARYTEAERARGRPLGAVDKYRL    141 - 210
RRKFPLPRTIWDGEETVYCFKEKSRNALKELYKQNRYPSPAEKRHLAKITGLSLTQVSNWFKNRRQRDRN    211 - 280
PSETQSKSESDGNPSTEDESSKGHEDLSPHPLSSSSDGITNLSLSSHMEPVYMQQIGNAKISLSSSGVLL    281 - 350
NGSLVPASTSPVFLNGNSFIQGPSGVILNGLNVGNTQAVALNPPKMSSNIVSNGISMTDILGSTSQDVKE    351 - 420
FKVLQSSANSATTTSYSPSVPVSFPGLIPSTEVKREGIQTVASQDGGSVVTFTTPVQINQYGIVQIPNSG    421 - 490
ANSQFLNGSIGFSPLQLPPVSVAASQGNISVSSSTSDGSTFTSESTTVQQGKVFLSSLAPSAVVYTVPNT    491 - 560
GQTIGSVKQEGLERSLVFSQLMPVNQNAQVNANLSSENISGSGLHPLASSLVNVSPTHNFSLSPSTLLNP    561 - 630
TELNRDIADSQPMSAPVASKSTVTSVSNTNYATLQNCSLITGQDLLSVPMTQAALGEIVPTAEDQVGHPS    631 - 700
PAVHQDFVQEHRLVLQSVANMKENFLSNSESKATSSLMMLDSKSKYVLDGMVDTVCEDLETDKKELAKLQ    701 - 770
TVQLDEDMQDL                                                               771 - 781
//

Text Mined References (10)

PMID Year Title
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14966291 2004 Quantitative proteomic identification of six4 as the trex-binding factor in the muscle creatine kinase enhancer.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10640827 1999 Structure and chromosome mapping of the human SIX4 and murine Six4 genes.
10512683 1999 Genomic cloning and characterization of the human homeobox gene SIX6 reveals a cluster of SIX genes in chromosome 14 and associates SIX6 hemizygosity with bilateral anophthalmia and pituitary anomalies.
8628654 1996 Structure, function and expression of a murine homeobox protein AREC3, a homologue of Drosophila sine oculis gene product, and implication in development.