Property Summary

NCBI Gene PubMed Count 63
Grant Count 20
R01 Count 16
Funding $1,946,567.72
PubMed Score 389.98
PubTator Score 430.06

Knowledge Summary

Patent

No data available

Expression

 GWAS Trait (1)

Gene RIF (32)

PMID Text
26311161 The substrate Angiotensin II, the enzymes aminopeptidases-A, B, M as well as IRAP were detected in the jejunal mucosa.
25408552 Determined is the crystal structure of human IRAP revealing a closed, four domain arrangement with a large, mostly buried cavity abutting the active site.
23897274 We identified the missense variant rs2303138 (p.Ala763Thr) within the LNPEP gene associated with psoriasis.
23889750 An association between maternal common polymorphisms in LNPEP and susceptibility to preterm birth was observed.
23500679 Activities of aminopeptidases N and B and insulin-regulated aminopeptidase could be useful non-invasive biomarkers of Alzheimer's disease from the earliest stages.
21348480 investigation of domain structure of IRAP; catalytic domains; inhibitor-binding domains; zinc binding sites
21330387 The genetic variation in LNPEP (vasopressinase) is associated with 28-day mortality in septic shock and is associated with biologic effects on vasopressin clearance and serum sodium regulation
21314638 S1 specificity pocket of the aminopeptidases that generate antigenic peptides.
20592285 Although PLAP has the necessary enzymatic properties to participate in generating or destroying major histocompatibility class I-presented peptides, its trimming behavior during antigen processing is distinct from that of ERAP1.
20304486 Expression of AT4R was increased in term placentae, with a significant reduction in pre-eclampsia placentae.
More...

AA Sequence

MEPFTNDRLQLPRNMIENSMFEEEPDVVDLAKEPCLHPLEPDEVEYEPRGSRLLVRGLGEHEMEEDEEDY      1 - 70
ESSAKLLGMSFMNRSSGLRNSATGYRQSPDGACSVPSARTMVVCAFVIVVAVSVIMVIYLLPRCTFTKEG     71 - 140
CHKKNQSIGLIQPFATNGKLFPWAQIRLPTAVVPLRYELSLHPNLTSMTFRGSVTISVQALQVTWNIILH    141 - 210
STGHNISRVTFMSAVSSQEKQAEILEYAYHGQIAIVAPEALLAGHNYTLKIEYSANISSSYYGFYGFSYT    211 - 280
DESNEKKYFAATQFEPLAARSAFPCFDEPAFKATFIIKIIRDEQYTALSNMPKKSSVVLDDGLVQDEFSE    281 - 350
SVKMSTYLVAFIVGEMKNLSQDVNGTLVSIYAVPEKIGQVHYALETTVKLLEFFQNYFEIQYPLKKLDLV    351 - 420
AIPDFEAGAMENWGLLTFREETLLYDSNTSSMADRKLVTKIIAHELAHQWFGNLVTMKWWNDLWLNEGFA    421 - 490
TFMEYFSLEKIFKELSSYEDFLDARFKTMKKDSLNSSHPISSSVQSSEQIEEMFDSLSYFKGSSLLLMLK    491 - 560
TYLSEDVFQHAVVLYLHNHSYASIQSDDLWDSFNEVTNQTLDVKRMMKTWTLQKGFPLVTVQKKGKELFI    561 - 630
QQERFFLNMKPEIQPSDTSYLWHIPLSYVTEGRNYSKYQSVSLLDKKSGVINLTEEVLWVKVNINMNGYY    631 - 700
IVHYADDDWEALIHQLKINPYVLSDKDRANLINNIFELAGLGKVPLKRAFDLINYLGNENHTAPITEALF    701 - 770
QTDLIYNLLEKLGYMDLASRLVTRVFKLLQNQIQQQTWTDEGTPSMRELRSALLEFACTHNLGNCSTTAM    771 - 840
KLFDDWMASNGTQSLPTDVMTTVFKVGAKTDKGWSFLLGKYISIGSEAEKNKILEALASSEDVRKLYWLM    841 - 910
KSSLNGDNFRTQKLSFIIRTVGRHFPGHLLAWDFVKENWNKLVQKFPLGSYTIQNIVAGSTYLFSTKTHL    911 - 980
SEVQAFFENQSEATFRLRCVQEALEVIQLNIQWMEKNLKSLTWWL                             981 - 1025
//

Text Mined References (71)

PMID Year Title
26311161 2015 Local expression of AP/AngIV/IRAP and effect of AngIV on glucose-induced epithelial transport in human jejunal mucosa.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25408552 2015 Crystal structure of human insulin-regulated aminopeptidase with specificity for cyclic peptides.
24957906 2014 A genome-wide association study identifies a functional ERAP2 haplotype associated with birdshot chorioretinopathy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23897274 2014 Identification of a missense variant in LNPEP that confers psoriasis risk.
23889750 2013 Sequence variants in oxytocin pathway genes and preterm birth: a candidate gene association study.
23500679 2013 Plasma renin-angiotensin system-regulating aminopeptidase activities are modified in early stage Alzheimer's disease and show gender differences but are not related to apolipoprotein E genotype.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...