Property Summary

NCBI Gene PubMed Count 63
PubMed Score 389.98
PubTator Score 430.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
ovarian cancer 8492 1.23916192709632E-6
Pick disease 1893 1.2991507579907E-6
medulloblastoma, large-cell 6234 4.68629178426759E-6
juvenile dermatomyositis 1189 5.34746100337424E-6
glioblastoma 5572 7.41601554525899E-6
Amyotrophic Lateral Sclerosis 432 1.25181816063508E-5
osteosarcoma 7933 6.38914538246271E-5
ductal carcinoma in situ 1745 3.78780878938503E-4
invasive ductal carcinoma 2950 0.00126790788714558
primitive neuroectodermal tumor 3031 0.00355163750935282
acute quadriplegic myopathy 1157 0.00394980526546043
group 3 medulloblastoma 2254 0.00551443076572895
atypical teratoid / rhabdoid tumor 4369 0.00655979567431465
adult high grade glioma 2148 0.00707656399032879
permanent atrial fibrillation 44 0.0106587164967954
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0128652672767336
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0150531313765511
pancreatic cancer 2300 0.0183896660890136
primary pancreatic ductal adenocarcinoma 1271 0.0208560676169958
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0268079284930945
spina bifida 1064 0.0490545238378325
Disease Target Count Z-score Confidence
pre-eclampsia 67 4.157 2.1
Placental insufficiency 13 3.425 1.7
Disease Target Count
Birdshot chorioretinopathy 23

Expression

Synonym

Accession Q9UIQ6 O00769 Q15145 Q59H76 Q9TNQ2 Q9TNQ3 Q9UIQ7 Cystinyl aminopeptidase
Symbols CAP
IRAP
PLAP
P-LAP

Gene

PANTHER Protein Class (3)

PDB

4P8Q   4PJ6   4Z7I   5C97  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

 GWAS Trait (1)

Gene RIF (32)

PMID Text
26311161 The substrate Angiotensin II, the enzymes aminopeptidases-A, B, M as well as IRAP were detected in the jejunal mucosa.
25408552 Determined is the crystal structure of human IRAP revealing a closed, four domain arrangement with a large, mostly buried cavity abutting the active site.
23897274 We identified the missense variant rs2303138 (p.Ala763Thr) within the LNPEP gene associated with psoriasis.
23889750 An association between maternal common polymorphisms in LNPEP and susceptibility to preterm birth was observed.
23500679 Activities of aminopeptidases N and B and insulin-regulated aminopeptidase could be useful non-invasive biomarkers of Alzheimer's disease from the earliest stages.
21348480 investigation of domain structure of IRAP; catalytic domains; inhibitor-binding domains; zinc binding sites
21330387 The genetic variation in LNPEP (vasopressinase) is associated with 28-day mortality in septic shock and is associated with biologic effects on vasopressin clearance and serum sodium regulation
21314638 S1 specificity pocket of the aminopeptidases that generate antigenic peptides.
20592285 Although PLAP has the necessary enzymatic properties to participate in generating or destroying major histocompatibility class I-presented peptides, its trimming behavior during antigen processing is distinct from that of ERAP1.
20304486 Expression of AT4R was increased in term placentae, with a significant reduction in pre-eclampsia placentae.
More...

AA Sequence

MEPFTNDRLQLPRNMIENSMFEEEPDVVDLAKEPCLHPLEPDEVEYEPRGSRLLVRGLGEHEMEEDEEDY      1 - 70
ESSAKLLGMSFMNRSSGLRNSATGYRQSPDGACSVPSARTMVVCAFVIVVAVSVIMVIYLLPRCTFTKEG     71 - 140
CHKKNQSIGLIQPFATNGKLFPWAQIRLPTAVVPLRYELSLHPNLTSMTFRGSVTISVQALQVTWNIILH    141 - 210
STGHNISRVTFMSAVSSQEKQAEILEYAYHGQIAIVAPEALLAGHNYTLKIEYSANISSSYYGFYGFSYT    211 - 280
DESNEKKYFAATQFEPLAARSAFPCFDEPAFKATFIIKIIRDEQYTALSNMPKKSSVVLDDGLVQDEFSE    281 - 350
SVKMSTYLVAFIVGEMKNLSQDVNGTLVSIYAVPEKIGQVHYALETTVKLLEFFQNYFEIQYPLKKLDLV    351 - 420
AIPDFEAGAMENWGLLTFREETLLYDSNTSSMADRKLVTKIIAHELAHQWFGNLVTMKWWNDLWLNEGFA    421 - 490
TFMEYFSLEKIFKELSSYEDFLDARFKTMKKDSLNSSHPISSSVQSSEQIEEMFDSLSYFKGSSLLLMLK    491 - 560
TYLSEDVFQHAVVLYLHNHSYASIQSDDLWDSFNEVTNQTLDVKRMMKTWTLQKGFPLVTVQKKGKELFI    561 - 630
QQERFFLNMKPEIQPSDTSYLWHIPLSYVTEGRNYSKYQSVSLLDKKSGVINLTEEVLWVKVNINMNGYY    631 - 700
IVHYADDDWEALIHQLKINPYVLSDKDRANLINNIFELAGLGKVPLKRAFDLINYLGNENHTAPITEALF    701 - 770
QTDLIYNLLEKLGYMDLASRLVTRVFKLLQNQIQQQTWTDEGTPSMRELRSALLEFACTHNLGNCSTTAM    771 - 840
KLFDDWMASNGTQSLPTDVMTTVFKVGAKTDKGWSFLLGKYISIGSEAEKNKILEALASSEDVRKLYWLM    841 - 910
KSSLNGDNFRTQKLSFIIRTVGRHFPGHLLAWDFVKENWNKLVQKFPLGSYTIQNIVAGSTYLFSTKTHL    911 - 980
SEVQAFFENQSEATFRLRCVQEALEVIQLNIQWMEKNLKSLTWWL                             981 - 1025
//

Text Mined References (71)

PMID Year Title
26311161 2015 Local expression of AP/AngIV/IRAP and effect of AngIV on glucose-induced epithelial transport in human jejunal mucosa.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25408552 2015 Crystal structure of human insulin-regulated aminopeptidase with specificity for cyclic peptides.
24957906 2014 A genome-wide association study identifies a functional ERAP2 haplotype associated with birdshot chorioretinopathy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23897274 2014 Identification of a missense variant in LNPEP that confers psoriasis risk.
23889750 2013 Sequence variants in oxytocin pathway genes and preterm birth: a candidate gene association study.
23500679 2013 Plasma renin-angiotensin system-regulating aminopeptidase activities are modified in early stage Alzheimer's disease and show gender differences but are not related to apolipoprotein E genotype.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...