Property Summary

NCBI Gene PubMed Count 16
PubMed Score 0.00
PubTator Score 7.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.836 0.000
tuberculosis -1.100 0.000
ovarian cancer -1.300 0.000

Gene RIF (8)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18584306 ZNF230 is tightly controlled at transcriptional level and a common mechanism controls the basal transcription of ZNF230 gene.
15952109 ZNF230 gene may be associated with azoospermia, and the A316G mutation may be correlated with the serum FSH level.
15952109 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MTTFKEAVTFKDVAVFFTEEELGLLDPAQRKLYQDVMLENFTNLLSVGHQPFHPFHFLREEKFWMMETAT      1 - 70
QREGNSGGKTIAEAGPHEDCPCQQIWEQTASDLTQSQDSIINNSHFFEQGDVPSQVEAGLSIIHTGQKPS     71 - 140
QNGKCKQSFSDVAIFDPPQQFHSGEKSHTCNECGKSFCYISALRIHQRVHLREKLSKCDMRGKEFSQSSC    141 - 210
LQTRERVHTGEKPFKCEQCGKGFRCRAILQVHCKLHTGEKPYICEKCGRAFIHDFQLQKHQIIHTGEKPF    211 - 280
KCEICGKSFCLRSSLNRHCMVHTAEKLYKSEECGKGFTDSLDLHKHQIIHTGQKPYNCKECGKSFRWSSY    281 - 350
LLIHQRIHSGEKPYRCEECGKGYISKSGLNLHQRVHTGERPYNCKECGKSFSRASSILNHKKLHCRKKPF    351 - 420
KCEDCGKRLVHRSFCKDQQGDHNGENSSKCEDCGKRYKRRLNLDIILSLFLNDM                    421 - 474
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19684603 2009 Germline genomic variants associated with childhood acute lymphoblastic leukemia.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18584306 2009 Spermatogenesis-related ring finger gene ZNF230 promoter: identification and functional analysis.
15952109 2005 Screening for ZNF230 gene mutation and analysis of its correlation with azoospermia.
15640038 2004 [Construction of recombinant ZNF230/GFP fused plasmids and their expression and cellular localization].
More...