Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.21
PubTator Score 6.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 5.0e-05
glioblastoma 1.400 3.2e-07
group 3 medulloblastoma 1.200 1.3e-02
juvenile dermatomyositis 1.064 4.7e-07
malignant mesothelioma 1.400 1.8e-06
medulloblastoma, large-cell 1.400 3.0e-04
non-small cell lung cancer 1.306 3.2e-08
osteosarcoma -1.661 2.3e-06
ovarian cancer 1.400 8.5e-03
pediatric high grade glioma 1.300 8.6e-06
primitive neuroectodermal tumor 1.200 2.0e-03
psoriasis -1.300 2.4e-04
tuberculosis 1.200 9.1e-04

Gene RIF (3)

AA Sequence

MNEYPKKRKRKTLHPSRYSDSSGISRIADGFNGIFSDHCYSVCSMRQPDLKYFDNKDDDSDTETSNDLPK      1 - 70
FADGIKARNRNQNYLVPSPVLRILDHTAFSTEKSADIVICDEECDSPESVNQQTQEESPIEVHTAEDVPI     71 - 140
AVEVHAISEDYDIETENNSSESLQDQTDEEPPAKLCKILDKSQALNVTAQQKWPLLRANSSGLYKCELCE    141 - 210
FNSKYFSDLKQHMILKHKRTDSNVCRVCKESFSTNMLLIEHAKLHEEDPYICKYCDYKTVIFENLSQHIA    211 - 280
DTHFSDHLYWCEQCDVQFSSSSELYLHFQEHSCDEQYLCQFCEHETNDPEDLHSHVVNEHACKLIELSDK    281 - 350
YNNGEHGQYSLLSKITFDKCKNFFVCQVCGFRSRLHTNVNRHVAIEHTKIFPHVCDDCGKGFSSMLEYCK    351 - 420
HLNSHLSEGIYLCQYCEYSTGQIEDLKIHLDFKHSADLPHKCSDCLMRFGNERELISHLPVHETT         421 - 485
//

Text Mined References (18)

PMID Year Title