Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.21
PubTator Score 6.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
non-small cell lung cancer 2798 3.17325735558939E-8
glioblastoma 5572 3.23716886494829E-7
juvenile dermatomyositis 1189 4.68075766095065E-7
tuberculosis and treatment for 6 months 686 5.66894005564024E-7
malignant mesothelioma 3163 1.75167900543694E-6
osteosarcoma 7933 2.26370134636137E-6
pediatric high grade glioma 2712 8.61488845484695E-6
pilocytic astrocytoma 3086 6.9356482020863E-5
psoriasis 6685 2.37654679437902E-4
medulloblastoma, large-cell 6234 2.99745851572815E-4
ovarian cancer 8492 4.35363841699072E-4
primitive neuroectodermal tumor 3031 0.00204163614403308
group 3 medulloblastoma 2254 0.00453710687609619
Disease Target Count Z-score Confidence
Celiac disease 112 0.0 1.0
Disease Target Count Z-score Confidence
Oral squamous cell carcinoma 9 3.156 1.6

Expression

  Differential Expression (13)

Synonym

Accession Q9UID6 A9X3Z9 D3DNR3
Symbols ZASC1
ANC-2H01
ANC_2H01

Gene

  Ortholog (10)

Gene RIF (3)

PMID Text
24204263 ZASC1 as novel regulator of HIV-1 gene expression that functions through the DNA-dependent, RNA-independent recruitment of TAT/P-TEFb to the HIV-1 promoter.
24204263 ZASC1 interacts with HIV-1 Tat and cellular proteins CDK9/Cyclin T1 (P-TEFb) in a TAR-independent manner, suggesting that the Tat/P-TEFb complex in the transcriptional elongation site is promoted by ZASC1
20646234 ZASC1 copy number that increased from primary to recurrent tumor suggested the importance of ZASC1 in tumor progression. The increase of ZASC1 gene copy number in recurrent tumors was associated with the consumption of betel quid in patients.

AA Sequence

MNEYPKKRKRKTLHPSRYSDSSGISRIADGFNGIFSDHCYSVCSMRQPDLKYFDNKDDDSDTETSNDLPK      1 - 70
FADGIKARNRNQNYLVPSPVLRILDHTAFSTEKSADIVICDEECDSPESVNQQTQEESPIEVHTAEDVPI     71 - 140
AVEVHAISEDYDIETENNSSESLQDQTDEEPPAKLCKILDKSQALNVTAQQKWPLLRANSSGLYKCELCE    141 - 210
FNSKYFSDLKQHMILKHKRTDSNVCRVCKESFSTNMLLIEHAKLHEEDPYICKYCDYKTVIFENLSQHIA    211 - 280
DTHFSDHLYWCEQCDVQFSSSSELYLHFQEHSCDEQYLCQFCEHETNDPEDLHSHVVNEHACKLIELSDK    281 - 350
YNNGEHGQYSLLSKITFDKCKNFFVCQVCGFRSRLHTNVNRHVAIEHTKIFPHVCDDCGKGFSSMLEYCK    351 - 420
HLNSHLSEGIYLCQYCEYSTGQIEDLKIHLDFKHSADLPHKCSDCLMRFGNERELISHLPVHETT         421 - 485
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24204263 2013 ZASC1 stimulates HIV-1 transcription elongation by recruiting P-TEFb and TAT to the LTR promoter.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20646234 2011 Increase of ZASC1 gene copy number in recurrent oral carcinoma.
20484494 2010 Cellular transcription factor ZASC1 regulates murine leukemia virus transcription.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17623809 2007 Functional persistence of exonized mammalian-wide interspersed repeat elements (MIRs).
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
More...