Property Summary

NCBI Gene PubMed Count 30
Grant Count 33
R01 Count 14
Funding $5,918,799.8
PubMed Score 28.08
PubTator Score 24.53

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

PMID Text
24635044 up-regulated in Kawasaki disease arteriopathy
23555300 These findings support a model in which CD84 genotypes and/or expression may serve as a useful biomarker for response to etanercept treatment in RA patients of European ancestry
23435417 data show that overexpression of CD84 in CLL is an important survival mechanism that appears to be an early event in the pathogenesis of the disease
22068234 CD84 is highly expressed in mast cells and that it contributes to the regulation of FcepsilonRI signaling
18243321 These data suggest that CD84 may play a role in modulating Fc epsilon RI-mediated signaling in mast cells.
17563375 The structure of CD84 provides insight into SLAM family function. Point mutations were studied.
12928397 CD84 enhances proliferation of human activated T cells by a Src homology 2 domain-containing cytoplasmic adaptor protein SLAM-associated protein (SAP)-independent mechanism.

AA Sequence

MAQHHLWILLLCLQTWPEAAGKDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSET      1 - 70
APVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQS     71 - 140
LMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQ    141 - 210
LCADIAMGFRTHHTGLLSVLAMFFLLVLILSSVFLFRLFKRRQGRIFPEGSCLNTFTKNPYAASKKTIYT    211 - 280
YIMASRNTQPAESRIYDEILQSKVLPSKEEPVNTVYSEVQFADKMGKASTQDSKPPGTSSYEIVI         281 - 345
//

Text Mined References (33)

PMID Year Title
24635044 2014 CD84 is markedly up-regulated in Kawasaki disease arteriopathy.
23555300 2013 Genome-wide association study and gene expression analysis identifies CD84 as a predictor of response to etanercept therapy in rheumatoid arthritis.
23435417 2014 CD84 is a survival receptor for CLL cells.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23322602 2013 Deciphering of ADP-induced, phosphotyrosine-dependent signaling networks in human platelets by Src-homology 2 region (SH2)-profiling.
22068234 2011 CD84 negatively regulates IgE high-affinity receptor signaling in human mast cells.
18243321 2008 The leukocyte receptor CD84 inhibits Fc epsilon RI-mediated signaling through homophilic interaction in transfected RBL-2H3 cells.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17563375 2007 Structure of CD84 provides insight into SLAM family function.
17192395 2007 Comparative gene expression profiling of in vitro differentiated megakaryocytes and erythroblasts identifies novel activatory and inhibitory platelet membrane proteins.
More...