Property Summary

NCBI Gene PubMed Count 31
PubMed Score 29.73
PubTator Score 24.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adult high grade glioma 1.500 8.1e-04
astrocytoma 1.600 3.6e-02
Astrocytoma, Pilocytic 1.300 1.6e-06
chronic lymphosyte leukemia 1.200 1.1e-04
cutaneous lupus erythematosus 1.800 7.7e-03
glioblastoma 1.500 8.6e-06
head and neck cancer and chronic obstruc... 1.100 5.5e-04
interstitial cystitis 1.900 3.6e-03
intraductal papillary-mucinous adenoma (... -1.500 1.2e-02
intraductal papillary-mucinous carcinoma... -2.100 2.5e-03
intraductal papillary-mucinous neoplasm ... -2.200 7.8e-03
invasive ductal carcinoma 1.265 3.7e-06
lung cancer -1.200 3.3e-03
lung carcinoma -1.900 1.0e-16
medulloblastoma, large-cell 1.300 4.5e-04
osteosarcoma 2.892 6.5e-04
ovarian cancer -1.300 6.0e-05
primary Sjogren syndrome 2.200 5.0e-05
psoriasis 1.200 5.3e-03
sarcoidosis 1.400 4.8e-02
subependymal giant cell astrocytoma 1.622 2.8e-02
ulcerative colitis 1.200 3.6e-04

Gene RIF (8)

AA Sequence

MAQHHLWILLLCLQTWPEAAGKDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSET      1 - 70
APVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQS     71 - 140
LMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQ    141 - 210
LCADIAMGFRTHHTGLLSVLAMFFLLVLILSSVFLFRLFKRRQGRIFPEGSCLNTFTKNPYAASKKTIYT    211 - 280
YIMASRNTQPAESRIYDEILQSKVLPSKEEPVNTVYSEVQFADKMGKASTQDSKPPGTSSYEIVI         281 - 345
//

Text Mined References (34)

PMID Year Title