Knowledge Summary

Patent

No data available

Synonym

Accession Q9UI54
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MESPKCLYSRITVNTAFGTKFSHISFIILFKVFLFPRITISKKTKLVTLSNYLNK                     1 - 55
//

Text Mined References (1)

PMID Year Title
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.