Property Summary

NCBI Gene PubMed Count 20
PubMed Score 69.18
PubTator Score 33.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Reflex sympathetic dystrophy 7 3.049 1.5

Expression

Gene RIF (16)

AA Sequence

MGRWCQTVARGQRPRTSAPSRAGALLLLLLLLRSAGCWGAGEAPGALSTADPADQSVQCVPKATCPSSRP      1 - 70
RLLWQTPTTQTLPSTTMETQFPVSEGKVDPYRSCGFSYEQDPTLRDPEAVARRWPWMVSVRANGTHICAG     71 - 140
TIIASQWVLTVAHCLIWRDVIYSVRVGSPWIDQMTQTASDVPVLQVIMHSRYRAQRFWSWVGQANDIGLL    141 - 210
KLKQELKYSNYVRPICLPGTDYVLKDHSRCTVTGWGLSKADGMWPQFRTIQEKEVIILNNKECDNFYHNF    211 - 280
TKIPTLVQIIKSQMMCAEDTHREKFCYELTGEPLVCSMEGTWYLVGLVSWGAGCQKSEAPPIYLQVSSYQ    281 - 350
HWIWDCLNGQALALPAPSRTLLLALPLPLSLLAAL                                       351 - 385
//

Text Mined References (20)

PMID Year Title