Property Summary

NCBI Gene PubMed Count 16
Grant Count 11
R01 Count 2
Funding $1,200,741.17
PubMed Score 65.80
PubTator Score 33.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Reflex sympathetic dystrophy 8 3.061 1.5

Expression

Gene RIF (12)

PMID Text
25811800 we found that some breast cancer diagnosis-associated features such as tumor size, tumor grade, estrogen receptors (ER) and progesterone receptors (PR) levels, were correlated well with TSP50/p65 and TSP50/MMP9 expression status
25399078 Results show that TSP50 is up-regulated in laryngocarcinoma tumour tissues and its down-regulation inhibits cell proliferation, reduces cell migration and induces cell apoptosis of laryngocarcinoma in NF-KB mediated pathway.
25312478 TSP50's threonine protease activity is crucial for its effects on tumor formation.
25077921 High TSP50 expression is associated with laryngocarcinoma.
25049081 The mutations in the catalytic triad of TSP50 could significantly depressed TSP50-mediated cell proliferation and tumor formation.
22574111 the importance of threonine 310, the most critical protease catalytic site in TSP50, to TSP50-induced cell proliferation and tumor formation
21765952 TSP50 is a potential effective indicator of poor survival for colorectal carcinoma patients, especially for those with early-stage tumors.
20506264 Results strongly suggest that bFGF mediates TSP50 downregulation by ERK1/2 activation, leading to the phosphorylation of Sp1 in this process.
18662669 These findings suggested that DNA methylation might regulate the TSP50 and mTSP50 gene expressions in different types of tissues and spermatic cells.
18462069 Overexpression of Sp1 and C/EBPbeta transcriptional factors upregulated the activities of the TSP50 promoter.
More...

AA Sequence

MGRWCQTVARGQRPRTSAPSRAGALLLLLLLLRSAGCWGAGEAPGALSTADPADQSVQCVPKATCPSSRP      1 - 70
RLLWQTPTTQTLPSTTMETQFPVSEGKVDPYRSCGFSYEQDPTLRDPEAVARRWPWMVSVRANGTHICAG     71 - 140
TIIASQWVLTVAHCLIWRDVIYSVRVGSPWIDQMTQTASDVPVLQVIMHSRYRAQRFWSWVGQANDIGLL    141 - 210
KLKQELKYSNYVRPICLPGTDYVLKDHSRCTVTGWGLSKADGMWPQFRTIQEKEVIILNNKECDNFYHNF    211 - 280
TKIPTLVQIIKSQMMCAEDTHREKFCYELTGEPLVCSMEGTWYLVGLVSWGAGCQKSEAPPIYLQVSSYQ    281 - 350
HWIWDCLNGQALALPAPSRTLLLALPLPLSLLAAL                                       351 - 385
//

Text Mined References (16)

PMID Year Title
25811800 2015 Testes-specific protease 50 promotes cell invasion and metastasis by increasing NF-kappaB-dependent matrix metalloproteinase-9 expression.
25399078 2014 Down-regulation of testes-specific protease 50 induces apoptosis in human laryngocarcinoma HEp2 cells in a NF-?B-mediated pathway.
25312478 2015 TSP50 depends on its threonine protease activity and its interactions with TNF-?-induced NF-?B for its role in human cervical tumorigenesis.
25077921 2014 Depression of testes-specific protease 50 (TSP50) inhibits cell proliferation and induces apoptosis in laryngocarcinoma.
25049081 2014 The catalytic triad of testes-specific protease 50 (TSP50) is essential for its function in cell proliferation.
22574111 2012 The threonine protease activity of testes-specific protease 50 (TSP50) is essential for its function in cell proliferation.
21765952 2011 High expression of testes-specific protease 50 is associated with poor prognosis in colorectal carcinoma.
20506264 2010 Basic FGF downregulates TSP50 expression via the ERK/Sp1 pathway.
18662669 2008 Differential methylation of TSP50 and mTSP50 genes in different types of human tissues and mouse spermatic cells.
18462069 2008 Identification and characterization of the human testes-specific protease 50 gene promoter.
More...