Property Summary

NCBI Gene PubMed Count 15
PubMed Score 2.26
PubTator Score 1.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytoma 1.100 2.0e-02
dermatomyositis 1.500 1.7e-03
fascioscapulohumeral muscular dystrophy 1.457 8.1e-06
group 4 medulloblastoma -2.700 6.0e-08
intraductal papillary-mucinous adenoma (... 1.400 1.1e-02
invasive ductal carcinoma -1.100 8.1e-03
lung cancer -1.400 2.7e-03
lung carcinoma -1.100 1.4e-20
malignant mesothelioma -1.500 8.4e-07
medulloblastoma, large-cell -1.400 2.4e-04
osteosarcoma 1.009 3.3e-03
ovarian cancer -1.600 8.7e-07
primary pancreatic ductal adenocarcinoma 1.092 4.8e-02

Gene RIF (4)

AA Sequence

MAADGDWQDFYEFQEPARSLLDQENCNASPEPGAEAGAEAGGGADGFPAPACSLEEKLSLCFRPSDPGAE      1 - 70
PPRTAVRPITERSLLQGDEIWNALTDNYGNVMPVDWKSSHTRTLHLLTLNLSEKGVSDSLLFDTSDDEEL     71 - 140
REQLDMHSIIVSCVNDEPLFTADQVIEEIEEMMQESPDPEDDETPTQSDRLSMLSQEIQTLKRSSTGSYE    141 - 210
ERVKRLSVSELNEILEEIETAIKEYSEELVQQLALRDELEFEKEVKNSFISVLIEVQNKQKEHKETAKKK    211 - 280
KKLKNGSSQNGKNERSHMPGTYLTTVIPYEKKNGPPSVEDLQILTKILRAMKEDSEKVPSLLTDYILKVL    281 - 350
CPT                                                                       351 - 353
//

Text Mined References (19)

PMID Year Title