Property Summary

NCBI Gene PubMed Count 15
PubMed Score 1.27
PubTator Score 1.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Gene RIF (4)

PMID Text
21408165 FEZ2 interacted with 59 proteins and that of these only 40 interacted with FEZ1.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
16484223 the C-terminal regions of FEZ1, and especially its coiled-coil region, are involved in its dimerization, its heterodimerization with FEZ2, and in the interaction with 10 of the identified interacting proteins

AA Sequence

MAADGDWQDFYEFQEPARSLLDQENCNASPEPGAEAGAEAGGGADGFPAPACSLEEKLSLCFRPSDPGAE      1 - 70
PPRTAVRPITERSLLQGDEIWNALTDNYGNVMPVDWKSSHTRTLHLLTLNLSEKGVSDSLLFDTSDDEEL     71 - 140
REQLDMHSIIVSCVNDEPLFTADQVIEEIEEMMQESPDPEDDETPTQSDRLSMLSQEIQTLKRSSTGSYE    141 - 210
ERVKRLSVSELNEILEEIETAIKEYSEELVQQLALRDELEFEKEVKNSFISVLIEVQNKQKEHKETAKKK    211 - 280
KKLKNGSSQNGKNERSHMPGTYLTTVIPYEKKNGPPSVEDLQILTKILRAMKEDSEKVPSLLTDYILKVL    281 - 350
CPT                                                                       351 - 353
//

Text Mined References (19)

PMID Year Title
25495476 2014 RAB3GAP1 and RAB3GAP2 modulate basal and rapamycin-induced autophagy.
24705354 2014 The palmitoyl acyltransferase HIP14 shares a high proportion of interactors with huntingtin: implications for a role in the pathogenesis of Huntington's disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21408165 2011 FEZ2 has acquired additional protein interaction partners relative to FEZ1: functional and evolutionary implications.
20812761 2010 Human FEZ1 protein forms a disulfide bond mediated dimer: implications for cargo transport.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
16484223 2006 FEZ1 dimerization and interaction with transcription regulatory proteins involves its coiled-coil region.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
More...