Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.39
PubTator Score 0.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
active Crohn's disease -1.183 2.3e-02
adult high grade glioma -1.600 5.0e-04
astrocytoma -1.200 1.9e-21
Astrocytoma, Pilocytic -1.500 4.9e-07
atypical teratoid / rhabdoid tumor -1.200 2.1e-03
cutaneous lupus erythematosus -1.400 1.7e-02
ependymoma -1.100 3.4e-02
esophageal adenocarcinoma -1.400 3.6e-02
glioblastoma -1.600 7.7e-11
group 3 medulloblastoma -1.600 3.4e-03
interstitial cystitis -2.000 8.5e-04
intraductal papillary-mucinous neoplasm ... 1.600 4.3e-03
medulloblastoma, large-cell -1.300 5.5e-04
non-small cell lung cancer 1.376 2.4e-08
oligodendroglioma -1.200 2.4e-17
pancreatic ductal adenocarcinoma liver m... 1.116 2.2e-02
Pick disease -1.400 4.7e-03
primitive neuroectodermal tumor -1.400 3.1e-04
psoriasis -1.100 1.5e-08
ulcerative colitis -1.600 1.8e-06

AA Sequence

MKPLEKFLKKQTSQLAGRTVAGGPGGGLGSCGGPGGGGGPGGGGGPAGGQRSLQRRQSVSRLLLPAFLRE      1 - 70
PPAEPGLEPPVPEEGGEPAGVAEEPGSGGPCWLQLEEVPGPGPLGGGGPLRSPSSYSSDELSPGEPLTSP     71 - 140
PWAPLGAPERPEHLLNRVLERLAGGATRDSAASDILLDDIVLTHSLFLPTEKFLQELHQYFVRAGGMEGP    141 - 210
EGLGRKQACLAMLLHFLDTYQGLLQEEEGAGHIIKDLYLLIMKDESLYQGLREDTLRLHQLVETVELKIP    211 - 280
EENQPPSKQVKPLFRHFRRIDSCLQTRVAFRGSDEIFCRVYMPDHSYVTIRSRLSASVQDILGSVTEKLQ    281 - 350
YSEEPAGREDSLILVAVSSSGEKVLLQPTEDCVFTALGINSHLFACTRDSYEALVPLPEEIQVSPGDTEI    351 - 420
HRVEPEDVANHLTAFHWELFRCVHELEFVDYVFHGERGRRETANLELLLQRCSEVTHWVATEVLLCEAPG    421 - 490
KRAQLLKKFIKIAALCKQNQDLLSFYAVVMGLDNAAVSRLRLTWEKLPGKFKNLFRKFENLTDPCRNHKS    491 - 560
YREVISKMKPPVIPFVPLILKDLTFLHEGSKTLVDGLVNIEKLHSVAEKVRTIRKYRSRPLCLDMEASPN    561 - 630
HLQTKAYVRQFQVIDNQNLLFELSYKLEANSQ                                          631 - 662
//

Text Mined References (7)

PMID Year Title