Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.39
PubTator Score 0.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
astrocytoma 1493 1.88788372740581E-21
oligodendroglioma 2849 2.41885068135357E-17
posterior fossa group B ependymoma 1530 1.871904005158E-14
glioblastoma 5572 7.68236541848166E-11
non-small cell lung cancer 2798 2.44550516233409E-8
pilocytic astrocytoma 3086 6.76700517567978E-7
pediatric high grade glioma 2712 1.21662076481866E-6
ulcerative colitis 2087 1.76163324037052E-6
psoriasis 6685 3.19130978169677E-5
interstitial cystitis 2299 4.15353002605977E-5
primitive neuroectodermal tumor 3031 3.13573660034023E-4
atypical teratoid/rhabdoid tumor 1095 4.69805704648736E-4
medulloblastoma, large-cell 6234 5.51613241266482E-4
group 3 medulloblastoma 2254 0.0033895537371704
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00427053098987424
Pick disease 1893 0.00471729070922306
cutaneous lupus erythematosus 1056 0.0165966006033487
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0215053297735488
active Crohn's disease 918 0.0232543844778705
esophageal adenocarcinoma 737 0.0360868328674662

Expression

Synonym

Accession Q9UHV5
Symbols Link-GEFII

Gene

PDB

2DHZ  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

AA Sequence

MKPLEKFLKKQTSQLAGRTVAGGPGGGLGSCGGPGGGGGPGGGGGPAGGQRSLQRRQSVSRLLLPAFLRE      1 - 70
PPAEPGLEPPVPEEGGEPAGVAEEPGSGGPCWLQLEEVPGPGPLGGGGPLRSPSSYSSDELSPGEPLTSP     71 - 140
PWAPLGAPERPEHLLNRVLERLAGGATRDSAASDILLDDIVLTHSLFLPTEKFLQELHQYFVRAGGMEGP    141 - 210
EGLGRKQACLAMLLHFLDTYQGLLQEEEGAGHIIKDLYLLIMKDESLYQGLREDTLRLHQLVETVELKIP    211 - 280
EENQPPSKQVKPLFRHFRRIDSCLQTRVAFRGSDEIFCRVYMPDHSYVTIRSRLSASVQDILGSVTEKLQ    281 - 350
YSEEPAGREDSLILVAVSSSGEKVLLQPTEDCVFTALGINSHLFACTRDSYEALVPLPEEIQVSPGDTEI    351 - 420
HRVEPEDVANHLTAFHWELFRCVHELEFVDYVFHGERGRRETANLELLLQRCSEVTHWVATEVLLCEAPG    421 - 490
KRAQLLKKFIKIAALCKQNQDLLSFYAVVMGLDNAAVSRLRLTWEKLPGKFKNLFRKFENLTDPCRNHKS    491 - 560
YREVISKMKPPVIPFVPLILKDLTFLHEGSKTLVDGLVNIEKLHSVAEKVRTIRKYRSRPLCLDMEASPN    561 - 630
HLQTKAYVRQFQVIDNQNLLFELSYKLEANSQ                                          631 - 662
//

Text Mined References (6)

PMID Year Title
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9789079 1998 A Rap guanine nucleotide exchange factor enriched highly in the basal ganglia.
9582122 1998 RasGRP, a Ras guanyl nucleotide- releasing protein with calcium- and diacylglycerol-binding motifs.