Property Summary

NCBI Gene PubMed Count 17
PubMed Score 27.36
PubTator Score 5.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Schizophrenia 1160 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Hypertensive Retinopathy 14 3.875 1.9
Retinitis pigmentosa 4 38 3.362 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.100 3.8e-02
osteosarcoma -1.439 1.6e-04
ovarian cancer 1.500 2.5e-05
posterior fossa group A ependymoma 1.100 7.1e-10

Gene RIF (6)

AA Sequence

MAGKKNVLSSLAVYAEDSEPESDGEAGIEAVGSAAEEKGGLVSDAYGEDDFSRLGGDEDGYEEEEDENSR      1 - 70
QSEDDDSETEKPEADDPKDNTEAEKRDPQELVASFSERVRNMSPDEIKIPPEPPGRCSNHLQDKIQKLYE     71 - 140
RKIKEGMDMNYIIQRKKEFRNPSIYEKLIQFCAIDELGTNYPKDMFDPHGWSEDSYYEALAKAQKIEMDK    141 - 210
LEKAKKERTKIEFVTGTKKGTTTNATSTTTTTASTAVADAQKRKSKWDSAIPVTTIAQPTILTTTATLPA    211 - 280
VVTVTTSASGSKTTVISAVGTIVKKAKQ                                              281 - 308
//

Text Mined References (27)

PMID Year Title