Property Summary

NCBI Gene PubMed Count 16
PubMed Score 29.25
PubTator Score 5.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.439 0.000
posterior fossa group B ependymoma 1.400 0.000
non primary Sjogren syndrome sicca 1.100 0.038
ovarian cancer 1.500 0.000

Synonym

Accession Q9UHR5 B3KML7 Q8N1R5 Q8TDR8 Q96D27
Symbols HTRG
HTRP
HCNGP

Gene

PANTHER Protein Class (1)

Gene RIF (5)

PMID Text
26350878 Two SNPs were significantly associated with rotator cuff tearing, residing in SAP30BP on chromosome 17 and SASH1 on chromosome 6.
21221920 The results indicate that HTRP could inhibit the transcription of a viral promoter, whose interaction with SAP30 synergistically affects transcriptional inhibition of the herpes simplex virus type 1 genes, and is related to HDAC enzyme activity.
20532202 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18854154 Knockdown of SAP30 binding protein (SAP30BP) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
15496587 HTRP is involved in cellular co-repressors

AA Sequence

MAGKKNVLSSLAVYAEDSEPESDGEAGIEAVGSAAEEKGGLVSDAYGEDDFSRLGGDEDGYEEEEDENSR      1 - 70
QSEDDDSETEKPEADDPKDNTEAEKRDPQELVASFSERVRNMSPDEIKIPPEPPGRCSNHLQDKIQKLYE     71 - 140
RKIKEGMDMNYIIQRKKEFRNPSIYEKLIQFCAIDELGTNYPKDMFDPHGWSEDSYYEALAKAQKIEMDK    141 - 210
LEKAKKERTKIEFVTGTKKGTTTNATSTTTTTASTAVADAQKRKSKWDSAIPVTTIAQPTILTTTATLPA    211 - 280
VVTVTTSASGSKTTVISAVGTIVKKAKQ                                              281 - 308
//

Text Mined References (25)

PMID Year Title
26350878 2016 Genome-wide association study for rotator cuff tears identifies two significant single-nucleotide polymorphisms.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21822266 2011 Exome sequencing supports a de novo mutational paradigm for schizophrenia.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...