Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.6e-28
Disease Target Count Z-score Confidence
Infertility 188 3.281 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.600 1.6e-28

AA Sequence

MVDKDTERDIEMKRQLRRLRELHLYSTWKKYQEAMKTSLGVPQCERDEGSLGKPLCPPEILSETLPGSVK      1 - 70
KRVCFPSEDHLEEFIAEHLPEASNQSLLTVAHADAGTQTNGDLEDLEEHGPGQTVSEEATEVHTMEGDPD     71 - 140
TLAEFLIRDVLQELSSYNGEEEDPEEVKTSLGVPQRGDLEDLEEHVPGQTVSEEATGVHMMQVDPATLAK    141 - 210
SDLEDLEEHVPEQTVSEEATGVHMMQVDPATLAKQLEDSTITGSHQQMSASPSSAPAEEATEKTKVEEEV    211 - 280
KTRKPKKKTRKPSKKSRWNVLKCWDIFNIF                                            281 - 310
//

Text Mined References (7)

PMID Year Title