Property Summary

NCBI Gene PubMed Count 17
PubMed Score 6.42
PubTator Score 6.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Liver cancer 604 0.0 0.5
Disease Target Count Z-score Confidence
Fragile X syndrome 34 3.452 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
intraductal papillary-mucinous carcinoma... -1.200 1.0e-02
malignant mesothelioma 1.700 5.8e-06

Gene RIF (3)

AA Sequence

MAEPTSDFETPIGWHASPELTPTLGPLSDTAPPRDSWMFWAMLPPPPPPLTSSLPAAGSKPSSESQPPME      1 - 70
AQSLPGAPPPFDAQILPGAQPPFDAQSPLDSQPQPSGQPWNFHASTSWYWRQSSDRFPRHQKSFNPAVKN     71 - 140
SYYPRKYDAKFTDFSLPPSRKQKKKKRKEPVFHFFCDTCDRGFKNQEKYDKHMSEHTKCPELDCSFTAHE    141 - 210
KIVQFHWRNMHAPGMKKIKLDTPEEIARWREERRKNYPTLANIERKKKLKLEKEKRGAVLTTTQYGKMKG    211 - 280
MSRHSQMAKIRSPGKNHKWKNDNSRQRAVTGSGSHLCDLKLEGPPEANADPLGVLINSDSESDKEEKPQH    281 - 350
SVIPKEVTPALCSLMSSYGSLSGSESEPEETPIKTEADVLAENQVLDSSAPKSPSQDVKATVRNFSEAKS    351 - 420
ENRKKSFEKTNPKRKKDYHNYQTLFEPRTHHPYLLEMLLAPDIRHERNVILQCVRYIIKKDFFGLDTNSA    421 - 490
KSKDV                                                                     491 - 495
//

Text Mined References (22)

PMID Year Title