Property Summary

NCBI Gene PubMed Count 11
PubMed Score 12.01
PubTator Score 6.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Breast cancer 2.200 3.3e-02
lung cancer 1.300 3.2e-03
ovarian cancer 1.500 2.2e-05

Gene RIF (3)

AA Sequence

MYQVPLPLDRDGTLVRLRFTMVALVTVCCPLVAFLFCILWSLLFHFKETTATHCGVPNYLPSVSSAIGGE      1 - 70
VPQRYVWRFCIGLHSAPRFLVAFAYWNHYLSCTSPCSCYRPLCRLNFGLNVVENLALLVLTYVSSSEDFT     71 - 140
IHENAFIVFIASSLGHMLLTCILWRLTKKHTVSQEDRKSYSWKQRLFIINFISFFSALAVYFRHNMYCEA    141 - 210
GVYTIFAILEYTVVLTNMAFHMTAWWDFGNKELLITSQPEEKRF                              211 - 254
//

Text Mined References (15)

PMID Year Title