Property Summary

NCBI Gene PubMed Count 11
PubMed Score 10.01
PubTator Score 6.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.400 0.000
Breast cancer 2.200 0.033
ovarian cancer 1.500 0.000

Synonym

Accession Q9UHJ9 E9PJG5 H7BXL9 Q6UC77 Q96G66 Q9UF01 Q9Y4N1
Symbols FRAG1
MRT17
MRT21
HPMRS3
CWH43-N

Gene

PANTHER Protein Class (1)

Gene RIF (3)

PMID Text
23561847 PGAP2 mutations, affecting the GPI-anchor-synthesis pathway, cause hyperphosphatasia with mental retardation syndrome.
23561846 Hypomorphic mutations in PGAP2, encoding a GPI-anchor-remodeling protein, cause autosomal-recessive intellectual disability.
19460752 Knockdown of post-GPI attachment to proteins 2 (PGAP2) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells

AA Sequence

MYQVPLPLDRDGTLVRLRFTMVALVTVCCPLVAFLFCILWSLLFHFKETTATHCGVPNYLPSVSSAIGGE      1 - 70
VPQRYVWRFCIGLHSAPRFLVAFAYWNHYLSCTSPCSCYRPLCRLNFGLNVVENLALLVLTYVSSSEDFT     71 - 140
IHENAFIVFIASSLGHMLLTCILWRLTKKHTVSQEDRKSYSWKQRLFIINFISFFSALAVYFRHNMYCEA    141 - 210
GVYTIFAILEYTVVLTNMAFHMTAWWDFGNKELLITSQPEEKRF                              211 - 254
//

Text Mined References (15)

PMID Year Title
26879448 2016 Congenital disorder of glycosylphosphatidylinositol (GPI)-anchor biosynthesis--The phenotype of two patients with novel mutations in the PIGN and PGAP2 genes.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25416956 2014 A proteome-scale map of the human interactome network.
23561847 2013 PGAP2 mutations, affecting the GPI-anchor-synthesis pathway, cause hyperphosphatasia with mental retardation syndrome.
23561846 2013 Hypomorphic mutations in PGAP2, encoding a GPI-anchor-remodeling protein, cause autosomal-recessive intellectual disability.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16407401 2006 PGAP2 is essential for correct processing and stable expression of GPI-anchored proteins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...