Property Summary

NCBI Gene PubMed Count 21
PubMed Score 169.41
PubTator Score 23.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 1.94495138084023E-27
psoriasis 6685 6.75331956084823E-23
group 3 medulloblastoma 2254 2.91606643129275E-5
lung adenocarcinoma 2714 4.43827268743786E-5
medulloblastoma, large-cell 6234 7.20194048777808E-4
Multiple Sclerosis 498 0.00304148125563272
glioblastoma 5572 0.0047753358760056
Pick disease 1893 0.00736814607006975
nephrosclerosis 329 0.0216296353039724
aldosterone-producing adenoma 664 0.0299777495072405

Expression

  Differential Expression (10)

Disease log2 FC p
nephrosclerosis -1.024 0.022
group 3 medulloblastoma -2.900 0.000
glioblastoma -1.900 0.005
medulloblastoma, large-cell -2.800 0.001
Multiple Sclerosis 1.900 0.003
aldosterone-producing adenoma -1.514 0.030
lung adenocarcinoma 1.600 0.000
lung carcinoma 1.800 0.000
Pick disease -1.500 0.007
psoriasis -1.900 0.000

Synonym

Accession Q9UHG2 Q4VC04
Symbols PEN
SAAS
SCG8
BigLEN
SgVIII
PROSAAS

Gene

  Ortholog (6)

Species Source
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG

Gene RIF (4)

PMID Text
22695173 Results show significant differences in distribution of single nucleotide polymorphism in this gene amongst whites and hispanics
18948394 Cloning of proSAAS homologs in Danio and Xenopus identifies conserved, putatively functional areas.
14746899 ProSAAS or proSAAS-like molecules are trapped within tau fibrils and accumulate in tau inclusions in patients with Alzheimer's disease and parkinsonism-dementia complex.
11719503 although both proSAAS and 7B2 potently inhibit PC enzymes via a C-terminal peptide, their intracellular interactions with PCs appear to differ significantly, with each binding protein exhibiting unique properties

AA Sequence

MAGSPLLWGPRAGGVGLLVLLLLGLFRPPPALCARPVKEPRGLSAASPPLAETGAPRRFRRSVPRGEAAG      1 - 70
AVQELARALAHLLEAERQERARAEAQEAEDQQARVLAQLLRVWGAPRNSDPALGLDDDPDAPAAQLARAL     71 - 140
LRARLDPAALAAQLVPAPVPAAALRPRPPVYDDGPAGPDAEEAGDETPDVDPELLRYLLGRILAGSADSE    141 - 210
GVAAPRRLRRAADHDVGSELPPEGVLGALLRVKRLETPAPQVPARRLLPP                        211 - 260
//

Text Mined References (24)

PMID Year Title
23383060 2013 Functional consequences of a novel variant of PCSK1.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23234360 2013 LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins.
23056534 2012 Pax6 directly down-regulates Pcsk1n expression thereby regulating PC1/3 dependent proinsulin processing.
22695173 Frequencies of obesity susceptibility alleles among ethnically and racially diverse bariatric patient populations.
22171320 2012 Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD.
22046305 2011 Peptide fingerprinting of Alzheimer's disease in cerebrospinal fluid: identification and prospective evaluation of new synaptic biomarkers.
21862681 2011 The extended granin family: structure, function, and biomedical implications.
21720444 2012 Common variants in FTO, MC4R, TMEM18, PRL, AIF1, and PCSK1 show evidence of association with adult obesity in the Greek population.
21311511 2011 High allelic burden of four obesity SNPs is associated with poorer weight loss outcomes following gastric bypass surgery.
More...