Property Summary

NCBI Gene PubMed Count 24
PubMed Score 350.76
PubTator Score 17.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0
Disease Target Count Z-score Confidence
Posterior polar cataract 6 3.63 1.8
Leukemia 104 3.346 1.7

Expression

  Differential Expression (21)

Disease log2 FC p
acute quadriplegic myopathy 1.468 2.1e-06
aldosterone-producing adenoma -1.203 1.8e-02
astrocytic glioma 1.500 3.7e-02
atypical teratoid / rhabdoid tumor 1.300 4.1e-05
Breast cancer 1.800 3.8e-02
ependymoma 1.500 4.2e-03
glioblastoma 1.200 1.7e-04
group 4 medulloblastoma 1.300 7.4e-04
intraductal papillary-mucinous adenoma (... 2.100 1.9e-03
intraductal papillary-mucinous carcinoma... 1.500 2.3e-03
juvenile dermatomyositis 1.019 1.5e-06
lung cancer -1.900 1.1e-02
malignant mesothelioma -1.200 9.6e-06
medulloblastoma, large-cell 1.400 4.5e-05
non-small cell lung cancer -1.196 7.0e-11
oligodendroglioma 1.500 3.3e-02
osteosarcoma 1.410 9.5e-04
ovarian cancer -1.400 7.3e-05
pancreatic cancer 1.300 1.5e-02
pediatric high grade glioma 1.100 8.3e-03
primary pancreatic ductal adenocarcinoma 1.327 1.9e-02

Protein-protein Interaction (9)

Gene RIF (29)

AA Sequence

MNREDRNVLRMKERERRNQEIQQGEDAFPPSSPLFAEPYKVTSKEDKLSSRIQSMLGNYDEMKDFIGDRS      1 - 70
IPKLVAIPKPTVPPSADEKSNPNFFEQRHGGSHQSSKWTPVGPAPSTSQSQKRSSGLQSGHSSQRTSAGS     71 - 140
SSGTNSSGQRHDRESYNNSGSSSRKKGQHGSEHSKSRSSSPGKPQAVSSLNSSHSRSHGNDHHSKEHQRS    141 - 210
KSPRDPDANWDSPSRVPFSSGQHSTQSFPPSLMSKSNSMLQKPTAYVRPMDGQESMEPKLSSEHYSSQSH    211 - 280
GNSMTELKPSSKAHLTKLKIPSQPLDASASGDVSCVDEILKEMTHSWPPPLTAIHTPCKTEPSKFPFPTK    281 - 350
ESQQSNFGTGEQKRYNPSKTSNGHQSKSMLKDDLKLSSSEDSDGEQDCDKTMPRSTPGSNSEPSHHNSEG    351 - 420
ADNSRDDSSSHSGSESSSGSDSESESSSSDSEANEPSQSASPEPEPPPTNKWQLDNWLNKVNPHKVSPAS    421 - 490
SVDSNIPSSQGYKKEGREQGTGNSYTDTSGPKETSSATPGRDSKTIQKGSESGRGRQKSPAQSDSTTQRR    491 - 560
TVGKKQPKKAEKAAAEEPRGGLKIESETPVDLASSMPSSRHKAATKGSRKPNIKKESKSSPRPTAEKKKY    561 - 630
KSTSKSSQKSREIIETDTSSSDSDESESLPPSSQTPKYPESNRTPVKPSSVEEEDSFFRQRMFSPMEEKE    631 - 700
LLSPLSEPDDRYPLIVKIDLNLLTRIPGKPYKETEPPKGEKKNVPEKHTREAQKQASEKVSNKGKRKHKN    701 - 770
EDDNRASESKKPKTEDKNSAGHKPSSNRESSKQSAAKEKDLLPSPAGPVPSKDPKTEHGSRKRTISQSSS    771 - 840
LKSSSNSNKETSGSSKNSSSTSKQKKTEGKTSSSSKEVKEKAPSSSSNCPPSAPTLDSSKPRRTKLVFDD    841 - 910
RNYSADHYLQEAKKLKHNADALSDRFEKAVYYLDAVVSFIECGNALEKNAQESKSPFPMYSETVDLIKYT    911 - 980
MKLKNYLAPDATAADKRLTVLCLRCESLLYLRLFKLKKENALKYSKTLTEHLKNSYNNSQAPSPGLGSKA    981 - 1050
VGMPSPVSPKLSPGNSGNYSSGASSASASGSSVTIPQKIHQMAASYVQVTSNFLYATEIWDQAEQLSKEQ   1051 - 1120
KEFFAELDKVMGPLIFNASIMTDLVRYTRQGLHWLRQDAKLIS                              1121 - 1163
//

Text Mined References (43)

PMID Year Title