Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.15
PubTator Score 9.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
breast carcinoma 1638 1.8e-02

Expression

  Differential Expression (1)

Disease log2 FC p
breast carcinoma 1.700 1.8e-02

Protein-protein Interaction (11)

Gene RIF (4)

AA Sequence

MPSPQLLVLFGSQTGTAQDVSERLGREARRRRLGCRVQALDSYPVVNLINEPLVIFVCATTGQGDPPDNM      1 - 70
KNFWRFIFRKNLPSTALCQMDFAVLGLGDSSYAKFNFVAKKLHRRLLQLGGSALLPVCLGDDQHELGPDA     71 - 140
AVDPWLRDLWDRVLGLYPPPPGLTEIPPGVPLPSKFTLLFLQEAPSTGSEGQRVAHPGSQEPPSESKPFL    141 - 210
APMISNQRVTGPSHFQDVRLIEFDILGSGISFAAGDVVLIQPSNSAAHVQRFCQVLGLDPDQLFMLQPRE    211 - 280
PDVSSPTRLPQPCSMRHLVSHYLDIASVPRRSFFELLACLSLHELEREKLLEFSSAQGQEELFEYCNRPR    281 - 350
RTILEVLCDFPHTAAAIPPDYLLDLIPVIRPRAFSIASSLLTHPSRLQILVAVVQFQTRLKEPRRGLCSS    351 - 420
WLASLDPGQGPVRVPLWVRPGSLAFPETPDTPVIMVGPGTGVAPFRAAIQERVAQGQTGNFLFFGCRWRD    421 - 490
QDFYWEAEWQELEKRDCLTLIPAFSREQEQKVYVQHRLRELGSLVWELLDRQGAYFYLAGNAKSMPADVS    491 - 560
EALMSIFQEEGGLCSPDAAAYLARLQQTRRFQTETWA                                     561 - 597
//

Text Mined References (18)

PMID Year Title