Property Summary

NCBI Gene PubMed Count 37
PubMed Score 8.40
PubTator Score 18.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 2.8e-08
diabetes mellitus 1728 1.1e-03
esophageal adenocarcinoma 737 2.0e-02
Disease Target Count Z-score Confidence
Glanders 5 3.973 2.0

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.300 2.8e-08
diabetes mellitus 1.200 1.1e-03
esophageal adenocarcinoma -1.800 2.0e-02

Synonym

Accession Q9UHA7 B2RAD9 Q53SR7 Q5BLR4 Q7RTZ8
Symbols FIL1
FIL1E
IL1F6
IL-1F6
IL1(EPSILON)
FIL1(EPSILON)

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (22)

AA Sequence

MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGL      1 - 70
NLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLIL     71 - 140
TQELGKANTTDFGLTMLF                                                        141 - 158
//

Text Mined References (39)

PMID Year Title