Property Summary

NCBI Gene PubMed Count 35
Grant Count 1
Funding $2,116.8
PubMed Score 7.40
PubTator Score 18.93

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (20)

PMID Text
26752465 Increased Expression of Interleukin-36 is associated with Inflammatory Bowel Disease.
26560022 IL-36alpha acts as a pro-inflammatory cytokine at cartilage level, by increasing the expression of markers of inflammation and cartilage catabolism.
26516833 Study shows that plasma concentrations of IL-36alpha and IL-36gamma are overexpressed in active systemic lupus erythematosus patients and that IL-36alpha has a substantial pro-inflammatory effect through regulation of IL-6 and CXCL8 production.
25902739 IL36A-IL36R axis is modulated in patients with primary Sjogren's syndrome.
25700962 increases maturation of monocyte-derived dendritic cells
25550854 IL-36alpha was highly expressed in nearly half of all colorectal cancer patients. Low expression level of IL-36alpha correlated with larger tumor size and advanced cancer stage. Low expression of IL-36alpha resulted in a poor prognosis of colorectal cancer patients.
24829417 IL-36 promotes myeloid cell infiltration, activation, and inflammatory activity in skin
24061617 Results show that IL-36alpha expression may play a pivotal role in determining the prognosis of hepatocellular carcinoma (HCC).
23268368 The novel cytokine interleukin-36alpha is expressed in psoriatic and rheumatoid arthritis synovium.
21965679 Interleukin-36 (IL-36) ligands require processing for full agonist (IL-36alpha, IL-36beta, and IL-36gamma) or antagonist (IL-36Ra) activity
More...

AA Sequence

MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGL      1 - 70
NLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLIL     71 - 140
TQELGKANTTDFGLTMLF                                                        141 - 158
//

Text Mined References (37)

PMID Year Title
26752465 2016 Increased Expression of Interleukin-36, a Member of the Interleukin-1 Cytokine Family, in Inflammatory Bowel Disease.
26560022 2015 IL-36?: a novel cytokine involved in the catabolic and inflammatory response in chondrocytes.
26516833 2015 Elevated Expression and Pro-Inflammatory Activity of IL-36 in Patients with Systemic Lupus Erythematosus.
25902739 2015 Interleukin-36? axis is modulated in patients with primary Sjögren's syndrome.
25700962 2015 IL-36? induces maturation of Th1-inducing human MDDC and synergises with IFN-? to induce high surface expression of CD14 and CD11c.
25550854 2014 Decreased expression of interleukin-36? predicts poor prognosis in colorectal cancer patients.
24829417 2014 IL-36 promotes myeloid cell infiltration, activation, and inflammatory activity in skin.
24061617 2013 Decreased expression of interleukin-36? correlates with poor prognosis in hepatocellular carcinoma.
23268368 2013 The novel cytokine interleukin-36? is expressed in psoriatic and rheumatoid arthritis synovium.
21965679 2011 Interleukin-36 (IL-36) ligands require processing for full agonist (IL-36?, IL-36?, and IL-36?) or antagonist (IL-36Ra) activity.
More...