Property Summary

NCBI Gene PubMed Count 50
PubMed Score 537.24
PubTator Score 154.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
breast carcinoma 1614 6.73798383002655E-31
juvenile dermatomyositis 1189 7.10075948401313E-10
lung adenocarcinoma 2714 3.28591451411228E-8
non-small cell lung cancer 2798 2.8650033866465E-7
chronic lymphosyte leukemia 232 3.68598841142558E-7
posterior fossa group B ependymoma 1530 7.84442827064013E-7
oligodendroglioma 2849 8.50841406468577E-7
cystic fibrosis 1670 8.71493126900166E-7
group 4 medulloblastoma 1875 9.35353919059062E-7
invasive ductal carcinoma 2950 4.3382110548725E-5
Duchenne muscular dystrophy 602 4.82441687433321E-5
ductal carcinoma in situ 1745 8.83621098786152E-5
psoriasis 6685 1.50463127312791E-4
ulcerative colitis 2087 4.41505984138101E-4
Pick disease 1893 8.56660341683987E-4
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00133447058625214
tuberculosis 1563 0.003002400233098
medulloblastoma, large-cell 6234 0.00324562744134969
nasopharyngeal carcinoma 1056 0.00331866588626647
fibroadenoma 557 0.00578563408284314
non-inflammatory breast cancer 208 0.00701095296017265
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00981051028956942
ovarian cancer 8492 0.0192933797062997
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0222840708133395
osteosarcoma 7933 0.0288715046931766
primitive neuroectodermal tumor 3031 0.0322713874370555
Atopic dermatitis 944 0.0360133749909631
Disease Target Count Z-score Confidence
Breast cancer 3099 0.0 2.0
Essential Hypertension 82 0.0 2.0
Disease Target Count Z-score Confidence
Postpartum depression 9 3.952 2.0
Cancer 2346 3.493 1.7

Expression

Synonym

Accession Q9UH73 Q8IW11 O/E-1
Symbols EBF
COE1
OLF1
O/E-1

Gene

PDB

3LYR   3MQI  

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Rat OMA Inparanoid
Cow OMA Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG

Gene RIF (27)

PMID Text
26900922 early B cell factor-1 (EBF1) was identified as a co-regulator of gene expression with MEF2C.
26819314 role in the expression of Latent membrane protein 1
26788497 two multi-zinc finger transcription cofactors named ZNF423 and ZNF521 have been characterised as potent inhibitors of EBF1 and are emerging as potentially relevant contributors to the development of B-cell leukaemias
26468528 Epstein-Barr Virus EBNA1 bound to host genes of high significance for B-cell growth and function, including MEF2B, IL6R, and EBF1.
25791133 Studied whether EBF1 expression and biological activity in white adipose tissue is related to different metabolic parameters.
25271088 EBF1 plays a role in connecting chronic psychosocial stress and central obesity as a risk factor for CVD.
23951143 A novel cross talk between ERbeta and Early B-cell Factor 1 (EBF1) was also identified and characterized.
23863747 The transcription factor EBF1 is an interaction partner for TET2, suggesting a sequence-specific mechanism for regulating DNA methylation.
23775715 Using a capture sequencing strategy, we discovered the B-cell relevant genes IRF8, EBF1, and TNFSF13 as novel targets for IGH deregulation.
23174882 Loss of EBF1 expression is associated with Hodgkin lymphoma.
More...

AA Sequence

MFGIQESIQRSGSSMKEEPLGSGMNAVRTWMQGAGVLDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHF      1 - 70
VLALYDRQGQPVEIERTAFVGFVEKEKEANSEKTNNGIHYRLQLLYSNGIRTEQDFYVRLIDSMTKQAIV     71 - 140
YEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRR    141 - 210
FQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEGTPSYLEHATPCIKAISPSEGWTTGGATV    211 - 280
IIIGDNFFDGLQVIFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGTPGRFIYTALNEP    281 - 350
TIDYGFQRLQKVIPRHPGDPERLPKEVILKRAADLVEALYGMPHNNQEIILKRAADIAEALYSVPRNHNQ    351 - 420
LPALANTSVHAGMMGVNSFSGQLAVNVSEASQATNQGFTRNSSSVSPHGYVPSTTPQQTNYNSVTTSMNG    421 - 490
YGSAAMSNLGGSPTFLNGSAANSPYAIVPSSPTMASSTSLPSNCSSSSGIFSFSPANMVSAVKQKSAFAP    491 - 560
VVRPQTSPPPTCTSTNGNSLQAISGMIVPPM                                           561 - 591
//

Text Mined References (52)

PMID Year Title
26900922 2016 MEF2C and EBF1 Co-regulate B Cell-Specific Transcription.
26819314 2016 Induction of Epstein-Barr Virus Oncoprotein LMP1 by Transcription Factors AP-2 and Early B Cell Factor.
26788497 2015 ZNF423 and ZNF521: EBF1 Antagonists of Potential Relevance in B-Lymphoid Malignancies.
26468528 2015 Identification of MEF2B, EBF1, and IL6R as Direct Gene Targets of Epstein-Barr Virus (EBV) Nuclear Antigen 1 Critical for EBV-Infected B-Lymphocyte Survival.
25791133 2015 Low early B-cell factor 1 (EBF1) activity in human subcutaneous adipose tissue is linked to a pernicious metabolic profile.
25416956 2014 A proteome-scale map of the human interactome network.
25271088 2015 Gene by stress genome-wide interaction analysis and path analysis identify EBF1 as a cardiovascular and metabolic risk gene.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25108383 2014 Genome-wide association analyses identify variants in developmental genes associated with hypospadias.
24688116 2014 Genome-wide association meta-analysis of human longevity identifies a novel locus conferring survival beyond 90 years of age.
More...