Property Summary

NCBI Gene PubMed Count 59
PubMed Score 600.35
PubTator Score 154.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Neoplastic Cell Transformation 89
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
lung cancer 4740 0.0 0.5
Disease Target Count Z-score Confidence
Breast cancer 3578 0.0 3.0
Essential Hypertension 94 0.0 3.0
Disease Target Count Z-score Confidence
Postpartum depression 8 4.04 2.0
Cancer 2499 3.62 1.8

Expression

  Differential Expression (27)

Disease log2 FC p
Atopic dermatitis -1.200 3.6e-02
autosomal dominant Emery-Dreifuss muscul... 1.606 1.3e-03
breast carcinoma -1.600 4.0e-05
chronic lymphosyte leukemia -2.900 3.7e-07
cystic fibrosis -2.492 8.9e-08
Duchenne muscular dystrophy 1.275 4.8e-05
ductal carcinoma in situ -2.600 8.8e-05
fibroadenoma -1.600 5.8e-03
group 3 medulloblastoma 3.900 7.8e-04
intraductal papillary-mucinous adenoma (... -2.100 9.8e-03
intraductal papillary-mucinous carcinoma... -2.300 2.2e-02
invasive ductal carcinoma -1.629 1.4e-04
juvenile dermatomyositis 1.262 7.1e-10
lung adenocarcinoma -1.600 3.3e-08
medulloblastoma, large-cell 2.300 2.5e-02
nasopharyngeal carcinoma -1.100 3.3e-03
non-inflammatory breast cancer -1.100 7.0e-03
non-small cell lung cancer -1.104 2.9e-07
oligodendroglioma 1.100 8.5e-07
osteosarcoma 1.398 2.9e-02
ovarian cancer -1.400 1.9e-02
Pick disease 1.400 3.8e-03
posterior fossa group A ependymoma 1.100 7.2e-03
primitive neuroectodermal tumor 2.000 3.2e-02
psoriasis -1.100 1.5e-04
tuberculosis -1.700 3.0e-03
ulcerative colitis 2.100 4.4e-04

Gene RIF (35)

AA Sequence

MFGIQESIQRSGSSMKEEPLGSGMNAVRTWMQGAGVLDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHF      1 - 70
VLALYDRQGQPVEIERTAFVGFVEKEKEANSEKTNNGIHYRLQLLYSNGIRTEQDFYVRLIDSMTKQAIV     71 - 140
YEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRR    141 - 210
FQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEGTPSYLEHATPCIKAISPSEGWTTGGATV    211 - 280
IIIGDNFFDGLQVIFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGTPGRFIYTALNEP    281 - 350
TIDYGFQRLQKVIPRHPGDPERLPKEVILKRAADLVEALYGMPHNNQEIILKRAADIAEALYSVPRNHNQ    351 - 420
LPALANTSVHAGMMGVNSFSGQLAVNVSEASQATNQGFTRNSSSVSPHGYVPSTTPQQTNYNSVTTSMNG    421 - 490
YGSAAMSNLGGSPTFLNGSAANSPYAIVPSSPTMASSTSLPSNCSSSSGIFSFSPANMVSAVKQKSAFAP    491 - 560
VVRPQTSPPPTCTSTNGNSLQAISGMIVPPM                                           561 - 591
//

Text Mined References (62)

PMID Year Title