Property Summary

NCBI Gene PubMed Count 50
Grant Count 153
R01 Count 105
Funding $18,652,847.74
PubMed Score 537.24
PubTator Score 154.19

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9UH73 Q8IW11 O/E-1
Symbols EBF
COE1
OLF1
O/E-1

Gene

PDB

3LYR   3MQI  

Gene RIF (27)

PMID Text
26900922 early B cell factor-1 (EBF1) was identified as a co-regulator of gene expression with MEF2C.
26819314 role in the expression of Latent membrane protein 1
26788497 two multi-zinc finger transcription cofactors named ZNF423 and ZNF521 have been characterised as potent inhibitors of EBF1 and are emerging as potentially relevant contributors to the development of B-cell leukaemias
26468528 Epstein-Barr Virus EBNA1 bound to host genes of high significance for B-cell growth and function, including MEF2B, IL6R, and EBF1.
25791133 Studied whether EBF1 expression and biological activity in white adipose tissue is related to different metabolic parameters.
25271088 EBF1 plays a role in connecting chronic psychosocial stress and central obesity as a risk factor for CVD.
23951143 A novel cross talk between ERbeta and Early B-cell Factor 1 (EBF1) was also identified and characterized.
23863747 The transcription factor EBF1 is an interaction partner for TET2, suggesting a sequence-specific mechanism for regulating DNA methylation.
23775715 Using a capture sequencing strategy, we discovered the B-cell relevant genes IRF8, EBF1, and TNFSF13 as novel targets for IGH deregulation.
23174882 Loss of EBF1 expression is associated with Hodgkin lymphoma.
More...

AA Sequence

MFGIQESIQRSGSSMKEEPLGSGMNAVRTWMQGAGVLDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHF      1 - 70
VLALYDRQGQPVEIERTAFVGFVEKEKEANSEKTNNGIHYRLQLLYSNGIRTEQDFYVRLIDSMTKQAIV     71 - 140
YEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRR    141 - 210
FQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEGTPSYLEHATPCIKAISPSEGWTTGGATV    211 - 280
IIIGDNFFDGLQVIFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGTPGRFIYTALNEP    281 - 350
TIDYGFQRLQKVIPRHPGDPERLPKEVILKRAADLVEALYGMPHNNQEIILKRAADIAEALYSVPRNHNQ    351 - 420
LPALANTSVHAGMMGVNSFSGQLAVNVSEASQATNQGFTRNSSSVSPHGYVPSTTPQQTNYNSVTTSMNG    421 - 490
YGSAAMSNLGGSPTFLNGSAANSPYAIVPSSPTMASSTSLPSNCSSSSGIFSFSPANMVSAVKQKSAFAP    491 - 560
VVRPQTSPPPTCTSTNGNSLQAISGMIVPPM                                           561 - 591
//

Text Mined References (52)

PMID Year Title
26900922 2016 MEF2C and EBF1 Co-regulate B Cell-Specific Transcription.
26819314 2016 Induction of Epstein-Barr Virus Oncoprotein LMP1 by Transcription Factors AP-2 and Early B Cell Factor.
26788497 2015 ZNF423 and ZNF521: EBF1 Antagonists of Potential Relevance in B-Lymphoid Malignancies.
26468528 2015 Identification of MEF2B, EBF1, and IL6R as Direct Gene Targets of Epstein-Barr Virus (EBV) Nuclear Antigen 1 Critical for EBV-Infected B-Lymphocyte Survival.
25791133 2015 Low early B-cell factor 1 (EBF1) activity in human subcutaneous adipose tissue is linked to a pernicious metabolic profile.
25416956 2014 A proteome-scale map of the human interactome network.
25271088 2015 Gene by stress genome-wide interaction analysis and path analysis identify EBF1 as a cardiovascular and metabolic risk gene.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25108383 2014 Genome-wide association analyses identify variants in developmental genes associated with hypospadias.
24688116 2014 Genome-wide association meta-analysis of human longevity identifies a novel locus conferring survival beyond 90 years of age.
More...