Property Summary

NCBI Gene PubMed Count 14
PubMed Score 4.60
PubTator Score 1.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Gene RIF (3)

PMID Text
22190034 HIV-1 NC is identified to have a physical interaction with nucleolar protein 12 (NOL12) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
19913121 Observational study of gene-disease association. (HuGE Navigator)
19460752 Knockdown of nucleolar protein 12 (NOL12) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells

AA Sequence

MGRNKKKKRDGDDRRPRLVLSFDEEKRREYLTGFHKRKVERKKAAIEEIKQRLKEEQRKLREERHQEYLK      1 - 70
MLAEREEALEEADELDRLVTAKTESVQYDHPNHTVTVTTISDLDLSGARLLGLTPPEGGAGDRSEEEASS     71 - 140
TEKPTKALPRKSRDPLLSQRISSLTASLHAHSRKKVKRKHPRRAQDSKKPPRAPRTSKAQRRRLTGKARH    141 - 210
SGE                                                                       211 - 213
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21153684 2011 Characterizing the novel protein p33MONOX.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16385458 2006 Mutations in a novel isoform of TRIOBP that encodes a filamentous-actin binding protein are responsible for DFNB28 recessive nonsyndromic hearing loss.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...