Property Summary

NCBI Gene PubMed Count 14
PubMed Score 4.60
PubTator Score 1.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 7.80897381250911E-4
lung cancer 4473 8.54732210894126E-4
psoriasis 6685 0.00201700747275945
interstitial lung disease 292 0.02613027056797

Synonym

Accession Q9UGY1
Symbols Nop25
dJ37E16.7

Gene

  Ortholog (12)

Gene RIF (3)

PMID Text
22190034 HIV-1 NC is identified to have a physical interaction with nucleolar protein 12 (NOL12) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
19913121 Observational study of gene-disease association. (HuGE Navigator)
19460752 Knockdown of nucleolar protein 12 (NOL12) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells

AA Sequence

MGRNKKKKRDGDDRRPRLVLSFDEEKRREYLTGFHKRKVERKKAAIEEIKQRLKEEQRKLREERHQEYLK      1 - 70
MLAEREEALEEADELDRLVTAKTESVQYDHPNHTVTVTTISDLDLSGARLLGLTPPEGGAGDRSEEEASS     71 - 140
TEKPTKALPRKSRDPLLSQRISSLTASLHAHSRKKVKRKHPRRAQDSKKPPRAPRTSKAQRRRLTGKARH    141 - 210
SGE                                                                       211 - 213
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21153684 2011 Characterizing the novel protein p33MONOX.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16385458 2006 Mutations in a novel isoform of TRIOBP that encodes a filamentous-actin binding protein are responsible for DFNB28 recessive nonsyndromic hearing loss.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...