Property Summary

NCBI Gene PubMed Count 15
PubMed Score 7.43
PubTator Score 8.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 2.95561741641889E-23
posterior fossa group B ependymoma 1530 2.57133731564805E-14
tuberculosis 1563 2.77754647011006E-9
atypical teratoid / rhabdoid tumor 4369 4.15562254371357E-7
pilocytic astrocytoma 3086 7.23582819862506E-7
sonic hedgehog group medulloblastoma 1482 2.30260100735031E-6
primitive neuroectodermal tumor 3031 4.72931554545868E-6
glioblastoma 5572 8.0242099757518E-6
osteosarcoma 7933 1.63335303871809E-5
medulloblastoma, large-cell 6234 3.82020240019602E-5
pituitary cancer 1972 1.4939263542347E-4
lung cancer 4473 0.00158072609555967
Pick disease 1893 0.00184968189716186
ovarian cancer 8492 0.00611448837047332
adult high grade glioma 2148 0.0067989959883546
primary pancreatic ductal adenocarcinoma 1271 0.00691935701822157
subependymal giant cell astrocytoma 2287 0.0088449316165743
aldosterone-producing adenoma 664 0.0170478475014714
acute myeloid leukemia 785 0.0443467020198768
Disease Target Count Z-score Confidence
Transitional papilloma 2 4.375 2.2
Motor peripheral neuropathy 7 4.298 2.1

Expression

  Differential Expression (19)

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

Gene RIF (7)

PMID Text
25936780 We identified a lactate-dependent signaling pathway in hypoxia, mediated by the oxygen- and lactate-regulated protein NDRG family member 3 (NDRG3).
24222185 the aberrant expression of NDRG2 and NDRG3 may contribute to the malignant progression of prostate cancer
23725756 summarizes the current research on NDRG3 and NDRG4,including the molecular structure, cellular and tissue distribution, biological function,and function in cancer.
21725618 miR-122 plays an important role in HBV-related hepatocarcinogenesis by targeting NDRG3.
19460752 Knockdown of NDRG family member 3 (NDRG3) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
18975380 NDRG3 is a tumor promoter, the overexpression of which may contribute to the malignant phenotype of tumors
11936845 Cloning and expression of the gene; highly expressed in brain and testis

AA Sequence

MDELQDVQLTEIKPLLNDKNGTRNFQDFDCQEHDIETTHGVVHVTIRGLPKGNRPVILTYHDIGLNHKSC      1 - 70
FNAFFNFEDMQEITQHFAVCHVDAPGQQEGAPSFPTGYQYPTMDELAEMLPPVLTHLSLKSIIGIGVGAG     71 - 140
AYILSRFALNHPELVEGLVLINVDPCAKGWIDWAASKLSGLTTNVVDIILAHHFGQEELQANLDLIQTYR    141 - 210
MHIAQDINQDNLQLFLNSYNGRRDLEIERPILGQNDNKSKTLKCSTLLVVGDNSPAVEAVVECNSRLNPI    211 - 280
NTTLLKMADCGGLPQVVQPGKLTEAFKYFLQGMGYIPSASMTRLARSRTHSTSSSLGSGESPFSRSVTSN    281 - 350
QSDGTQESCESPDVLDRHQTMEVSC                                                 351 - 375
//

Text Mined References (25)

PMID Year Title
25936780 2015 NDRG3-mediated lactate signaling in hypoxia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24222185 2014 Prognostic impact of NDRG2 and NDRG3 in prostate cancer patients undergoing radical prostatectomy.
23725756 2013 NDRG3 and NDRG4, two novel tumor-related genes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21725618 2011 miR-122 inhibits viral replication and cell proliferation in hepatitis B virus-related hepatocellular carcinoma and targets NDRG3.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...