Property Summary

NCBI Gene PubMed Count 15
PubMed Score 7.43
PubTator Score 8.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Gene RIF (7)

PMID Text
25936780 We identified a lactate-dependent signaling pathway in hypoxia, mediated by the oxygen- and lactate-regulated protein NDRG family member 3 (NDRG3).
24222185 the aberrant expression of NDRG2 and NDRG3 may contribute to the malignant progression of prostate cancer
23725756 summarizes the current research on NDRG3 and NDRG4,including the molecular structure, cellular and tissue distribution, biological function,and function in cancer.
21725618 miR-122 plays an important role in HBV-related hepatocarcinogenesis by targeting NDRG3.
19460752 Knockdown of NDRG family member 3 (NDRG3) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
18975380 NDRG3 is a tumor promoter, the overexpression of which may contribute to the malignant phenotype of tumors
11936845 Cloning and expression of the gene; highly expressed in brain and testis

AA Sequence

MDELQDVQLTEIKPLLNDKNGTRNFQDFDCQEHDIETTHGVVHVTIRGLPKGNRPVILTYHDIGLNHKSC      1 - 70
FNAFFNFEDMQEITQHFAVCHVDAPGQQEGAPSFPTGYQYPTMDELAEMLPPVLTHLSLKSIIGIGVGAG     71 - 140
AYILSRFALNHPELVEGLVLINVDPCAKGWIDWAASKLSGLTTNVVDIILAHHFGQEELQANLDLIQTYR    141 - 210
MHIAQDINQDNLQLFLNSYNGRRDLEIERPILGQNDNKSKTLKCSTLLVVGDNSPAVEAVVECNSRLNPI    211 - 280
NTTLLKMADCGGLPQVVQPGKLTEAFKYFLQGMGYIPSASMTRLARSRTHSTSSSLGSGESPFSRSVTSN    281 - 350
QSDGTQESCESPDVLDRHQTMEVSC                                                 351 - 375
//

Text Mined References (25)

PMID Year Title
25936780 2015 NDRG3-mediated lactate signaling in hypoxia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24222185 2014 Prognostic impact of NDRG2 and NDRG3 in prostate cancer patients undergoing radical prostatectomy.
23725756 2013 NDRG3 and NDRG4, two novel tumor-related genes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21725618 2011 miR-122 inhibits viral replication and cell proliferation in hepatitis B virus-related hepatocellular carcinoma and targets NDRG3.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...