Property Summary

NCBI Gene PubMed Count 18
PubMed Score 11.70
PubTator Score 8.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
acute myeloid leukemia -1.100 4.4e-02
adult high grade glioma -1.700 1.1e-05
aldosterone-producing adenoma -1.167 1.7e-02
Astrocytoma, Pilocytic -1.100 4.3e-07
atypical teratoid / rhabdoid tumor -1.800 2.0e-10
ependymoma -1.700 4.8e-02
glioblastoma -1.500 1.4e-09
lung cancer 1.900 1.6e-03
lung carcinoma 1.200 3.0e-23
medulloblastoma -1.200 8.8e-08
medulloblastoma, large-cell -1.400 3.8e-05
osteosarcoma -1.456 4.2e-04
ovarian cancer 1.200 6.1e-03
Pick disease -1.100 9.5e-04
pituitary cancer 1.400 1.5e-04
primary pancreatic ductal adenocarcinoma 1.102 6.9e-03
primitive neuroectodermal tumor -1.500 5.6e-07
subependymal giant cell astrocytoma -2.137 2.3e-02
tuberculosis 1.300 2.5e-08

Gene RIF (10)

AA Sequence

MDELQDVQLTEIKPLLNDKNGTRNFQDFDCQEHDIETTHGVVHVTIRGLPKGNRPVILTYHDIGLNHKSC      1 - 70
FNAFFNFEDMQEITQHFAVCHVDAPGQQEGAPSFPTGYQYPTMDELAEMLPPVLTHLSLKSIIGIGVGAG     71 - 140
AYILSRFALNHPELVEGLVLINVDPCAKGWIDWAASKLSGLTTNVVDIILAHHFGQEELQANLDLIQTYR    141 - 210
MHIAQDINQDNLQLFLNSYNGRRDLEIERPILGQNDNKSKTLKCSTLLVVGDNSPAVEAVVECNSRLNPI    211 - 280
NTTLLKMADCGGLPQVVQPGKLTEAFKYFLQGMGYIPSASMTRLARSRTHSTSSSLGSGESPFSRSVTSN    281 - 350
QSDGTQESCESPDVLDRHQTMEVSC                                                 351 - 375
//

Text Mined References (28)

PMID Year Title