Property Summary

NCBI Gene PubMed Count 35
PubMed Score 41.28
PubTator Score 49.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 2.7e-04
breast carcinoma 1.600 5.8e-04
cutaneous lupus erythematosus 1.500 1.9e-03
glioblastoma 2.100 2.1e-04
head and neck cancer and chronic obstruc... 1.100 1.1e-03
interstitial cystitis 1.500 6.1e-04
intraductal papillary-mucinous adenoma (... -1.200 2.3e-03
intraductal papillary-mucinous carcinoma... -1.100 2.0e-02
lung cancer -1.600 7.1e-03
osteosarcoma -1.872 9.7e-03
ovarian cancer 1.200 9.1e-04
subependymal giant cell astrocytoma 1.716 4.5e-03
ulcerative colitis 1.500 4.6e-06

Gene RIF (24)

AA Sequence

MWLPWALLLLWVPGCFALSKCRTVAGPVGGSLSVQCPYEKEHRTLNKYWCRPPQIFLCDKIVETKGSAGK      1 - 70
RNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPVVEVEVSVFPASTSMTPASITAAK     71 - 140
TSTITTAFPPVSSTTLFAVGATHSASIQEETEEVVNSQLPLLLSLLALLLLLLVGASLLAWRMFQKWIKA    141 - 210
GDHSELSQNPKQAATQSELHYANLELLMWPLQEKPAPPREVEVEYSTVASPREELHYASVVFDSNTNRIA    211 - 280
AQRPREEEPDSDYSVIRKT                                                       281 - 299
//

Text Mined References (37)

PMID Year Title