Property Summary

NCBI Gene PubMed Count 34
Grant Count 7
R01 Count 3
Funding $501,221.77
PubMed Score 38.46
PubTator Score 49.52

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9UGN4 A8MW96 O95100 Q9HD97 Q9P0F3 Q9UBK4 Q9UMS9 Q9UMT0 CLM-8
Symbols IRC1
IRC2
CLM-8
IRp60
IGSF12
CMRF35H
CMRF-35H
CMRF35-H
CMRF35H9
CMRF35-H9
IRC1/IRC2
CMRF-35-H9

Gene

PDB

2Q87  

Gene RIF (23)

PMID Text
26581992 US3 protein kinase of pseudorabies virus triggers the binding of the inhibitory natural killer cell receptor CD300a to the surface of the infected cell, and protects of virus infected cells against natural killer cell-mediated lysis.
26468529 Overall, these data indicate that CD300a is a novel Dengue virus binding receptor that recognizes phosphatidylethanolamine and phosphatidylserine present on virions and enhance infection.
26435477 High CD300A expression is associated with diffuse large B-cell lymphoma.
24958459 Data show that peroxisome proliferator activator receptor delta (PPARdelta/beta) directly regulates CD300a protein in macrophages.
24815424 interaction with phosphatidylserines inhibits IgE/FcepsilonRI-dependent anaphylactic basophil degranulation
24131792 CD300a induction by the hypoxic environment represents a mechanism of regulation of monocyte/macrophage pro-inflammatory responses at pathologic sites
24058511 The inhibitory receptor CD300a is regulator of monocytes transendothelial migration.
23333304 HIV-1 Vif downregulates the expression of CD300a molecule (CD300A) in Vif-expression T cells
22537350 SHP-1, but not SHP-2 or the src homology 2 domain containing inositol 5' phosphatase SHIP, was utilized by CD300a for its inhibitory activity. These studies provide new insights into the function of CD300a in tuning T and B cell responses.
22302738 our results indicate that phosphatidylethanolamine and phosphatidylserine are ligands for CD300a, and that this interaction plays an important role in regulating the removal of dead cells.
More...

AA Sequence

MWLPWALLLLWVPGCFALSKCRTVAGPVGGSLSVQCPYEKEHRTLNKYWCRPPQIFLCDKIVETKGSAGK      1 - 70
RNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPVVEVEVSVFPASTSMTPASITAAK     71 - 140
TSTITTAFPPVSSTTLFAVGATHSASIQEETEEVVNSQLPLLLSLLALLLLLLVGASLLAWRMFQKWIKA    141 - 210
GDHSELSQNPKQAATQSELHYANLELLMWPLQEKPAPPREVEVEYSTVASPREELHYASVVFDSNTNRIA    211 - 280
AQRPREEEPDSDYSVIRKT                                                       281 - 299
//

Text Mined References (36)

PMID Year Title
26581992 2015 Pseudorabies Virus US3 Protein Kinase Protects Infected Cells from NK Cell-Mediated Lysis via Increased Binding of the Inhibitory NK Cell Receptor CD300a.
26468529 2015 The Phosphatidylserine and Phosphatidylethanolamine Receptor CD300a Binds Dengue Virus and Enhances Infection.
26435477 2015 Suppression of CD300A inhibits the growth of diffuse large B-cell lymphoma.
25416956 2014 A proteome-scale map of the human interactome network.
24958459 2014 PPAR?/? activation of CD300a controls intestinal immunity.
24815424 2014 Mechanism of phosphatidylserine inhibition of IgE/Fc?RI-dependent anaphylactic human basophil degranulation via CD300a.
24131792 2014 Identification of CD300a as a new hypoxia-inducible gene and a regulator of CCL20 and VEGF production by human monocytes and macrophages.
24058511 2013 Transcriptional profiling of human monocytes identifies the inhibitory receptor CD300a as regulator of transendothelial migration.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22537350 2012 Functional requirements for inhibitory signal transmission by the immunomodulatory receptor CD300a.
More...