Property Summary

NCBI Gene PubMed Count 59
Grant Count 59
R01 Count 30
Funding $6,941,104.3
PubMed Score 150.61
PubTator Score 74.03

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9UGL1 O95811 Q15752 Q9Y3Q5
Symbols CT31
PLU1
PUT1
PLU-1
JARID1B
PPP1R98
RBP2-H1
RBBP2H1A

Gene

PDB

2MA5   2MNY   2MNZ   5A1F   5A3N   5A3P   5A3T   5A3W   5FPL   5FPU   5FUN   5FUP   5FV3   5FYT   5FYU   5FYY   5FYZ   5FZ0   5FZ1   5FZ3   5FZ4   5FZ6   5FZ7   5FZ9   5FZA   5FZB   5FZC   5FZH   5FZK   5FZL  

Gene RIF (51)

PMID Text
26911146 Data show that KDM5B is frequently up-regulated in hepatocellular carcinoma tissues and cell lines and correlated with poor prognosis. Its depletion leads to highly impaired clonogenesis and cell cycle arrest through up-regulation of p15 and p27.
26655717 the presented data suggest a mechanism through which Ikaros and HDAC1 regulate the epigenetic signature in leukemia: via regulation of JARID1B transcription.
26645689 Characterization of a Linked Jumonji Domain of the KDM5/JARID1 Family of Histone H3 Lysine 4 Demethylases.
26621457 KDM5B, a histone demethylase known to be involved in breast cancer tumorigenesis, as a target of miR-137.
26184998 Silencing shJARID1B inhibits migration and invasion of human oral squamous cell carcinoma, reduces cancer stem cell activities and potentiates tumor-inhibiting radiotherapeutic effects.
26125737 The data demonstrated that protein expression of p16 and JARID1B/KDM5B is negatively correlated in invasive ductal carcinoma of the breast.
25951238 provided evidence that JARID1B via modulation of stemness-related signaling is a putative novel therapeutic target for treating malignant NB
25909289 Our results, for the first time, portray a pivotal role of JARID1B in stimulating metastatic behaviors of hepatocellular carcinoma cells
25877751 Our results collectively suggested that JARID1B expressed in lung cancer played a role in lung cancer cells proliferation and invasion, which may be partly associated with the p53 expression
25777981 PLU-1/JARID1B represents a candidate proliferation biomarker for HNSCC diagnosis and treatment.
More...

AA Sequence

MEAATTLHPGPRPALPLGGPGPLGEFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDW      1 - 70
QPPFACDVDKLHFTPRIQRLNELEAQTRVKLNFLDQIAKYWELQGSTLKIPHVERKILDLFQLNKLVAEE     71 - 140
GGFAVVCKDRKWTKIATKMGFAPGKAVGSHIRGHYERILNPYNLFLSGDSLRCLQKPNLTTDTKDKEYKP    141 - 210
HDIPQRQSVQPSETCPPARRAKRMRAEAMNIKIEPEETTEARTHNLRRRMGCPTPKCENEKEMKSSIKQE    211 - 280
PIERKDYIVENEKEKPKSRSKKATNAVDLYVCLLCGSGNDEDRLLLCDGCDDSYHTFCLIPPLHDVPKGD    281 - 350
WRCPKCLAQECSKPQEAFGFEQAARDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEED    351 - 420
VTVEYGADIASKEFGSGFPVRDGKIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVG    421 - 490
MCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNT    491 - 560
LMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHD    561 - 630
EMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCF    631 - 700
MSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAESYNEWALNVNEALEAKI    701 - 770
NKKKSLVSFKALIEESEMKKFPDNDLLRHLRLVTQDAEKCASVAQQLLNGKRQTRYRSGGGKSQNQLTVN    771 - 840
ELRQFVTQLYALPCVLSQTPLLKDLLNRVEDFQQHSQKLLSEETPSAAELQDLLDVSFEFDVELPQLAEM    841 - 910
RIRLEQARWLEEVQQACLDPSSLTLDDMRRLIDLGVGLAPYSAVEKAMARLQELLTVSEHWDDKAKSLLK    911 - 980
ARPRHSLNSLATAVKEIEEIPAYLPNGAALKDSVQRARDWLQDVEGLQAGGRVPVLDTLIELVTRGRSIP    981 - 1050
VHLNSLPRLETLVAEVQAWKECAVNTFLTENSPYSLLEVLCPRCDIGLLGLKRKQRKLKEPLPNGKKKST   1051 - 1120
KLESLSDLERALTESKETASAMATLGEARLREMEALQSLRLANEGKLLSPLQDVDIKICLCQKAPAAPMI   1121 - 1190
QCELCRDAFHTSCVAVPSISQGLRIWLCPHCRRSEKPPLEKILPLLASLQRIRVRLPEGDALRYMIERTV   1191 - 1260
NWQHRAQQLLSSGNLKFVQDRVGSGLLYSRWQASAGQVSDTNKVSQPPGTTSFSLPDDWDNRTSYLHSPF   1261 - 1330
STGRSCIPLHGVSPEVNELLMEAQLLQVSLPEIQELYQTLLAKPSPAQQTDRSSPVRPSSEKNDCCRGKR   1331 - 1400
DGINSLERKLKRRLEREGLSSERWERVKKMRTPKKKKIKLSHPKDMNNFKLERERSYELVRSAETHSLPS   1401 - 1470
DTSYSEQEDSEDEDAICPAVSCLQPEGDEVDWVQCDGSCNQWFHQVCVGVSPEMAEKEDYICVRCTVKDA   1471 - 1540
PSRK                                                                     1541 - 1544
//

Text Mined References (69)

PMID Year Title
26911146 2016 Depletion of histone demethylase KDM5B inhibits cell proliferation of hepatocellular carcinoma by regulation of cell cycle checkpoint proteins p15 and p27.
26655717 2016 Transcriptional Regulation of JARID1B/KDM5B Histone Demethylase by Ikaros, Histone Deacetylase 1 (HDAC1), and Casein Kinase 2 (CK2) in B-cell Acute Lymphoblastic Leukemia.
26645689 2016 Characterization of a Linked Jumonji Domain of the KDM5/JARID1 Family of Histone H3 Lysine 4 Demethylases.
26621457 2016 MicroRNAs regulate KDM5 histone demethylases in breast cancer cells.
26184998 2015 Silencing JARID1B suppresses oncogenicity, stemness and increases radiation sensitivity in human oral carcinoma.
26125737 2015 Immunohistochemical detection and clinicopathological significance of JARID1B/KDM5B and P16 expression in invasive ductal carcinoma of the breast.
25951238 2015 JARID1B Expression Plays a Critical Role in Chemoresistance and Stem Cell-Like Phenotype of Neuroblastoma Cells.
25909289 2015 JARID1B promotes metastasis and epithelial-mesenchymal transition via PTEN/AKT signaling in hepatocellular carcinoma cells.
25877751 2015 JARID1B modulates lung cancer cell proliferation and invasion by regulating p53 expression.
25777981 2015 PLU-1/JARID1B overexpression predicts proliferation properties in head and neck squamous cell carcinoma.
More...