Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.33
PubTator Score 1.00

Knowledge Summary

Patent (245)

TINX Plot

  Disease (3)

Gene RIF (3)

AA Sequence

MENVTTMNEFLLLGLTGVQELQPFFFGIFLIIYLINLIGNGSILVMVVLEPQLHSPMYFFLGNLSCLDIS      1 - 70
YSSVTLPKLLVNLVCSRRAISFLGCITQLHFFHFLGSTEAILLAIMAFDRFVAICNPLRYTVIMNPQVCI     71 - 140
LLAAAAWLISFFYALMHSVMTAHLSFCGSQKLNHFFYDVKPLLELACSDTLLNQWLLSIVTGSISMGAFF    141 - 210
LTLLSCFYVIGFLLFKNRSCRILHKALSTCASHFMVVCLFYGPVGFTYIRPASATSMIQDRIMAIMYSAV    211 - 280
TPVLNPLIYTLRNKEVMMALKKIFGRKLFKDWQQHH                                      281 - 316
//

Text Mined References (11)

PMID Year Title