Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.33
PubTator Score 1.00

Knowledge Summary

Patent (245)

Gene RIF (3)

PMID Text
20466734 Observational study of gene-disease association. (HuGE Navigator)
20205591 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MENVTTMNEFLLLGLTGVQELQPFFFGIFLIIYLINLIGNGSILVMVVLEPQLHSPMYFFLGNLSCLDIS      1 - 70
YSSVTLPKLLVNLVCSRRAISFLGCITQLHFFHFLGSTEAILLAIMAFDRFVAICNPLRYTVIMNPQVCI     71 - 140
LLAAAAWLISFFYALMHSVMTAHLSFCGSQKLNHFFYDVKPLLELACSDTLLNQWLLSIVTGSISMGAFF    141 - 210
LTLLSCFYVIGFLLFKNRSCRILHKALSTCASHFMVVCLFYGPVGFTYIRPASATSMIQDRIMAIMYSAV    211 - 280
TPVLNPLIYTLRNKEVMMALKKIFGRKLFKDWQQHH                                      281 - 316
//

Text Mined References (11)

PMID Year Title
24047820 2013 Common variation contributes to the genetic architecture of social communication traits.
23393555 2013 Genome-wide association study of retinopathy in individuals without diabetes.
20466734 2010 Refining the association of MHC with multiple sclerosis in African Americans.
20205591 2010 Host determinants of HIV-1 control in African Americans.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12637542 2003 Complex transcription and splicing of odorant receptor genes.
More...