Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.00
PubTator Score 8.00

Knowledge Summary

Patent (64)

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 5.3e-09
diabetes mellitus 1728 2.3e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Gene RIF (1)

AA Sequence

MVNLTSMSGFLLMGFSDERKLQILHALVFLVTYLLALTGNLLIITIITVDRRLHSPMYYFLKHLSLLDLC      1 - 70
FISVTVPQSIANSLMGNGYISLVQCILQVFFFIALASSEVAILTVMSYDRYAAICQPLHYETIMDPRACR     71 - 140
HAVIAVWIAGGLSGLMHAAINFSIPLCGKRVIHQFFCDVPQMLKLACSYEFINEIALAAFTTSAAFICLI    141 - 210
SIVLSYIRIFSTVLRIPSAEGRTKVFSTCLPHLFVATFFLSAAGFEFLRLPSDSSSTVDLVFSVFYTVIP    211 - 280
PTLNPVIYSLRNDSMKAALRKMLSKEELPQRKMCLKAMFKL                                 281 - 321
//

Text Mined References (5)

PMID Year Title