Property Summary

NCBI Gene PubMed Count 24
Grant Count 15
R01 Count 3
Funding $1,888,101.34
PubMed Score 18.52
PubTator Score 16.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma -1.800 0.000
astrocytoma -1.900 0.002
posterior fossa group B ependymoma -2.300 0.000
oligodendroglioma -1.200 0.049
atypical teratoid / rhabdoid tumor -1.900 0.000
medulloblastoma, large-cell -1.500 0.002
non-small cell lung cancer 1.383 0.000
interstitial cystitis -1.200 0.005
adult high grade glioma -1.100 0.003
subependymal giant cell astrocytoma -1.838 0.020
lung adenocarcinoma 1.100 0.000
lung carcinoma 2.300 0.000
spina bifida -2.385 0.027
invasive ductal carcinoma -1.100 0.013
ovarian cancer -1.100 0.000
pituitary cancer -1.100 0.002

 GWAS Trait (1)

Gene RIF (16)

PMID Text
22591552 Variation in RGS17 was associated with risk for substance dependence diagnoses in both African American and European American populations.
22006218 Two single nucleotide polymorphisms in the regulator of G-protein signaling 17 gene are associated with smoking initiation.
21620966 RGS17 is differentially expressed in hepatocellular carcinoma cells and plays a central role in regulating transformed hepatocyte tumorgenicity.
21044322 Results establish RGS10 and RGS17 as novel regulators of cell survival and chemoresistance in ovarian cancer cells and suggest that their reduced expression may be diagnostic of chemoresistance.
20453000 Observational study of gene-disease association. (HuGE Navigator)
20420807 Taken together, these data have provided the first evidence of miRNA regulation of RGS17 expression in lung cancer.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20306291 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTKMESIQVLEEC      1 - 70
QNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDY     71 - 140
ISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSES    141 - 210
//

Text Mined References (25)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
22591552 2012 Variation in regulator of G-protein signaling 17 gene (RGS17) is associated with multiple substance dependence diagnoses.
22006218 2012 Large-scale genome-wide association study of Asian population reveals genetic factors in FRMD4A and other loci influencing smoking initiation and nicotine dependence.
21620966 2011 Altered expression and function of regulator of G-protein signaling-17 (RGS17) in hepatocellular carcinoma.
21044322 2010 Regulators of G-Protein signaling RGS10 and RGS17 regulate chemoresistance in ovarian cancer cells.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20420807 2010 Hsa-mir-182 suppresses lung tumorigenesis through down regulation of RGS17 expression in vitro.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20306291 2010 A three-stage genome-wide association study of general cognitive ability: hunting the small effects.
More...