Property Summary

NCBI Gene PubMed Count 25
PubMed Score 22.62
PubTator Score 16.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.100 2.7e-03
astrocytic glioma -1.300 1.8e-02
atypical teratoid / rhabdoid tumor -1.900 3.3e-06
ependymoma -1.600 8.7e-03
interstitial cystitis -1.200 5.3e-03
invasive ductal carcinoma -1.100 1.3e-02
lung adenocarcinoma 1.100 5.0e-05
lung carcinoma 2.300 2.1e-39
malignant mesothelioma -1.800 2.3e-05
medulloblastoma, large-cell -1.500 1.5e-03
non-small cell lung cancer 1.383 3.2e-10
oligodendroglioma -1.200 4.9e-02
ovarian cancer -1.100 1.7e-04
pituitary cancer -1.100 2.0e-03
spina bifida -2.385 2.7e-02
subependymal giant cell astrocytoma -1.838 2.0e-02

Gene RIF (17)

AA Sequence

MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTKMESIQVLEEC      1 - 70
QNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDY     71 - 140
ISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSES    141 - 210
//

Text Mined References (26)

PMID Year Title