Property Summary

NCBI Gene PubMed Count 24
PubMed Score 18.52
PubTator Score 16.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 2.10291382520958E-39
posterior fossa group B ependymoma 1530 1.36943008152704E-12
non-small cell lung cancer 2798 3.18555644297321E-10
atypical teratoid / rhabdoid tumor 4369 3.34616531894691E-6
malignant mesothelioma 3163 2.27186423134994E-5
lung adenocarcinoma 2714 5.01681880858472E-5
ovarian cancer 8492 1.74391726442731E-4
medulloblastoma, large-cell 6234 0.00153818267978385
pituitary cancer 1972 0.00195124529275375
astrocytoma 1493 0.00208477304926659
adult high grade glioma 2148 0.00270421628385951
interstitial cystitis 2299 0.0053093756194063
invasive ductal carcinoma 2950 0.0134436313118179
subependymal giant cell astrocytoma 2287 0.020057095502606
spina bifida 1064 0.0265050367167052
oligodendroglioma 2849 0.0494855442378315
Disease Target Count Z-score Confidence
Prostate cancer 172 0.0 2.0

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma -1.800 0.000
astrocytoma -1.900 0.002
posterior fossa group B ependymoma -2.300 0.000
oligodendroglioma -1.200 0.049
atypical teratoid / rhabdoid tumor -1.900 0.000
medulloblastoma, large-cell -1.500 0.002
non-small cell lung cancer 1.383 0.000
interstitial cystitis -1.200 0.005
adult high grade glioma -1.100 0.003
subependymal giant cell astrocytoma -1.838 0.020
lung adenocarcinoma 1.100 0.000
lung carcinoma 2.300 0.000
spina bifida -2.385 0.027
invasive ductal carcinoma -1.100 0.013
ovarian cancer -1.100 0.000
pituitary cancer -1.100 0.002

Synonym

Accession Q9UGC6 Q5TF49 Q8TD61 Q9UJS8 RGS17
Symbols RGSZ2
RGS-17
hRGS17

Gene

PDB

1ZV4  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (16)

PMID Text
22591552 Variation in RGS17 was associated with risk for substance dependence diagnoses in both African American and European American populations.
22006218 Two single nucleotide polymorphisms in the regulator of G-protein signaling 17 gene are associated with smoking initiation.
21620966 RGS17 is differentially expressed in hepatocellular carcinoma cells and plays a central role in regulating transformed hepatocyte tumorgenicity.
21044322 Results establish RGS10 and RGS17 as novel regulators of cell survival and chemoresistance in ovarian cancer cells and suggest that their reduced expression may be diagnostic of chemoresistance.
20453000 Observational study of gene-disease association. (HuGE Navigator)
20420807 Taken together, these data have provided the first evidence of miRNA regulation of RGS17 expression in lung cancer.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20306291 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTKMESIQVLEEC      1 - 70
QNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDY     71 - 140
ISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSES    141 - 210
//

Text Mined References (25)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
22591552 2012 Variation in regulator of G-protein signaling 17 gene (RGS17) is associated with multiple substance dependence diagnoses.
22006218 2012 Large-scale genome-wide association study of Asian population reveals genetic factors in FRMD4A and other loci influencing smoking initiation and nicotine dependence.
21620966 2011 Altered expression and function of regulator of G-protein signaling-17 (RGS17) in hepatocellular carcinoma.
21044322 2010 Regulators of G-Protein signaling RGS10 and RGS17 regulate chemoresistance in ovarian cancer cells.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20420807 2010 Hsa-mir-182 suppresses lung tumorigenesis through down regulation of RGS17 expression in vitro.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20306291 2010 A three-stage genome-wide association study of general cognitive ability: hunting the small effects.
More...