Property Summary

NCBI Gene PubMed Count 11
PubMed Score 8.35
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
active Crohn's disease 1.544 3.0e-02
acute myeloid leukemia -1.700 4.9e-02
adult high grade glioma 2.000 1.0e-03
aldosterone-producing adenoma -1.067 4.0e-02
astrocytoma 1.100 1.0e-07
Astrocytoma, Pilocytic 2.400 2.0e-08
glioblastoma 2.200 1.5e-07
interstitial cystitis 1.100 5.5e-03
juvenile dermatomyositis 1.941 1.1e-13
lung adenocarcinoma -1.100 1.6e-08
lung carcinoma -2.400 5.5e-20
medulloblastoma, large-cell -1.500 7.1e-04
non-small cell lung cancer -1.600 1.6e-12
ovarian cancer -3.300 2.3e-08
primary Sjogren syndrome 2.600 4.8e-05
sarcoidosis 1.800 2.5e-02
ulcerative colitis 2.100 1.2e-06

Gene RIF (2)

AA Sequence

MDQNEHSHWGPHAKGQCASRSELRIILVGKTGTGKSAAGNSILRKQAFESKLGSQTLTKTCSKSQGSWGN      1 - 70
REIVIIDTPDMFSWKDHCEALYKEVQRCYLLSAPGPHVLLLVTQLGRYTSQDQQAAQRVKEIFGEDAMGH     71 - 140
TIVLFTHKEDLNGGSLMDYMHDSDNKALSKLVAACGGRICAFNNRAEGSNQDDQVKELMDCIEDLLMEKN    141 - 210
GDHYTNGLYSLIQRSKCGPVGSDERVKEFKQSLIKYMETQRSYTALAEANCLKGALIKTQLCVLFCIQLF    211 - 280
LRLIILWLCILHSMCNLFCCLLFSMCNLFCSLLFIIPKKLMIFLRTVIRLERKTPRL                 281 - 337
//

Text Mined References (12)

PMID Year Title