Property Summary

NCBI Gene PubMed Count 10
PubMed Score 8.35
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 5.51878227847261E-20
juvenile dermatomyositis 1189 1.06265522120578E-13
non-small cell lung cancer 2798 1.64975200188089E-12
pilocytic astrocytoma 3086 2.26524545438796E-8
ovarian cancer 8492 2.33127743230295E-8
astrocytoma 1493 1.04852395766592E-7
glioblastoma 5572 1.48517699330621E-7
lung adenocarcinoma 2714 8.29537317292892E-7
ulcerative colitis 2087 1.23273179193746E-6
pediatric high grade glioma 2712 2.12443677801417E-5
primary Sjogren syndrome 789 4.84561262846469E-5
medulloblastoma, large-cell 6234 7.14384500096577E-4
interstitial cystitis 2299 0.00553481303179689
sarcoidosis 368 0.0248639769346687
active Crohn's disease 918 0.0302978511423513
aldosterone-producing adenoma 664 0.0396880539346444
acute myeloid leukemia 785 0.0491588653551526
Disease Target Count Z-score Confidence
Behcet's disease 74 3.454 1.7

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytoma 1.100 0.000
glioblastoma 2.200 0.000
medulloblastoma, large-cell -1.500 0.001
juvenile dermatomyositis 1.941 0.000
non-small cell lung cancer -1.600 0.000
active Crohn's disease 1.544 0.030
sarcoidosis 1.800 0.025
interstitial cystitis 1.100 0.006
lung adenocarcinoma -1.300 0.000
pediatric high grade glioma 2.000 0.000
pilocytic astrocytoma 2.400 0.000
primary Sjogren syndrome 2.600 0.000
aldosterone-producing adenoma -1.067 0.040
lung carcinoma -2.400 0.000
acute myeloid leukemia -1.700 0.049
ulcerative colitis 2.100 0.000
ovarian cancer -3.300 0.000

Synonym

Accession Q9UG22 Q96L25
Symbols IAN12
IMAP2
HIMAP2

Gene

PDB

2XTM   2XTN   2XTO   2XTP   3P1J  

  Ortholog (4)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Pig OMA EggNOG

Gene RIF (2)

PMID Text
20516611 GDP-bound GIMAP2(21-260) and GDP-bound GIMAP2(1-234) crystallized in space group P2(1)2(1)2(1) and the crystals diffracted X-rays to 2.9 and 1.7 A resolution, respectively.
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDQNEHSHWGPHAKGQCASRSELRIILVGKTGTGKSAAGNSILRKQAFESKLGSQTLTKTCSKSQGSWGN      1 - 70
REIVIIDTPDMFSWKDHCEALYKEVQRCYLLSAPGPHVLLLVTQLGRYTSQDQQAAQRVKEIFGEDAMGH     71 - 140
TIVLFTHKEDLNGGSLMDYMHDSDNKALSKLVAACGGRICAFNNRAEGSNQDDQVKELMDCIEDLLMEKN    141 - 210
GDHYTNGLYSLIQRSKCGPVGSDERVKEFKQSLIKYMETQRSYTALAEANCLKGALIKTQLCVLFCIQLF    211 - 280
LRLIILWLCILHSMCNLFCCLLFSMCNLFCSLLFIIPKKLMIFLRTVIRLERKTPRL                 281 - 337
//

Text Mined References (12)

PMID Year Title
23454188 2013 Structural insights into the mechanism of GTPase activation in the GIMAP family.
21685187 2011 Genome-wide association study of smoking behaviours in patients with COPD.
21059949 2010 Structural basis of oligomerization in septin-like GTPase of immunity-associated protein 2 (GIMAP2).
20516611 2010 Purification, crystallization and preliminary X-ray analysis of human GIMAP2.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15474311 2004 Comparative analysis of the human gimap gene cluster encoding a novel GTPase family.
12690205 2003 Human chromosome 7: DNA sequence and biology.
More...