Property Summary

NCBI Gene PubMed Count 10
Grant Count 1
Funding $239,845.2
PubMed Score 8.35
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytoma 1.100 0.000
glioblastoma 2.200 0.000
medulloblastoma, large-cell -1.500 0.001
juvenile dermatomyositis 1.941 0.000
non-small cell lung cancer -1.600 0.000
active Crohn's disease 1.544 0.030
sarcoidosis 1.800 0.025
interstitial cystitis 1.100 0.006
lung adenocarcinoma -1.300 0.000
pediatric high grade glioma 2.000 0.000
pilocytic astrocytoma 2.400 0.000
primary Sjogren syndrome 2.600 0.000
aldosterone-producing adenoma -1.067 0.040
lung carcinoma -2.400 0.000
acute myeloid leukemia -1.700 0.049
ulcerative colitis 2.100 0.000
ovarian cancer -3.300 0.000

Gene RIF (2)

PMID Text
20516611 GDP-bound GIMAP2(21-260) and GDP-bound GIMAP2(1-234) crystallized in space group P2(1)2(1)2(1) and the crystals diffracted X-rays to 2.9 and 1.7 A resolution, respectively.
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDQNEHSHWGPHAKGQCASRSELRIILVGKTGTGKSAAGNSILRKQAFESKLGSQTLTKTCSKSQGSWGN      1 - 70
REIVIIDTPDMFSWKDHCEALYKEVQRCYLLSAPGPHVLLLVTQLGRYTSQDQQAAQRVKEIFGEDAMGH     71 - 140
TIVLFTHKEDLNGGSLMDYMHDSDNKALSKLVAACGGRICAFNNRAEGSNQDDQVKELMDCIEDLLMEKN    141 - 210
GDHYTNGLYSLIQRSKCGPVGSDERVKEFKQSLIKYMETQRSYTALAEANCLKGALIKTQLCVLFCIQLF    211 - 280
LRLIILWLCILHSMCNLFCCLLFSMCNLFCSLLFIIPKKLMIFLRTVIRLERKTPRL                 281 - 337
//

Text Mined References (12)

PMID Year Title
23454188 2013 Structural insights into the mechanism of GTPase activation in the GIMAP family.
21685187 2011 Genome-wide association study of smoking behaviours in patients with COPD.
21059949 2010 Structural basis of oligomerization in septin-like GTPase of immunity-associated protein 2 (GIMAP2).
20516611 2010 Purification, crystallization and preliminary X-ray analysis of human GIMAP2.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15474311 2004 Comparative analysis of the human gimap gene cluster encoding a novel GTPase family.
12690205 2003 Human chromosome 7: DNA sequence and biology.
More...