Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MGHLDKEGLCTQGSSFSWLLRVLNDGISLGLTPCLWDMYLLEGEQMLMLITSIAFKVQRSLYEETNKETW      1 - 70
GPATPRALKGTGRARPICESLHSSLQALTASESSRGPSLLQTPPRVPGQQALSRGDKGISVSLSLPSLPS     71 - 140
RRGRCGRIIG                                                                141 - 150
//

Text Mined References (4)

PMID Year Title