Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 2.9e-06
medulloblastoma, large-cell -1.700 1.5e-05
tuberculosis and treatment for 6 months -1.300 3.3e-05

Gene RIF (2)

AA Sequence

MGSKAKKRVLLPTRPAPPTVEQILEDVRGAPAEDPVFTILAPEDPPVPFRMMEDAEAPGEQLYQQSRAYV      1 - 70
AANQRLQQAGNVLRQRCELLQRAGEDLEREVAQMKQAALPAAEAASSG                           71 - 118
//

Text Mined References (14)

PMID Year Title