Property Summary

NCBI Gene PubMed Count 36
Grant Count 35
R01 Count 27
Funding $3,147,804.33
PubMed Score 667.95
PubTator Score 2175.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Gene RIF (14)

PMID Text
25944446 These results indicate that Caf1 and Ccr4 cooperate in mRNA deadenylation and suggest that the enzyme activities of Caf1 and Ccr4 are regulated via allosteric interactions within the nuclease module.
25038453 CNOT7/hCAF1 is involved in ICAM-1 and IL-8 regulation by TTP in HPMEC.
24115769 show that SMG7 binds directly to POP2, a catalytic subunit of the CCR4-NOT deadenylase complex, and elicits deadenylation-dependent decapping and 5'-to-3' decay of NMD targets
24036545 The loss of CAF-1 p48 subunit causes a strong defect in packaging DNA into nucleosomes.
23236473 The anti-proliferative activity of BTG/TOB proteins is mediated via the Caf1a (CNOT7) and Caf1b (CNOT8) deadenylase subunits of the Ccr4-not complex.
22977175 The NOT1 MIF4G domain binds CAF1 through a pre-formed interface and leaves the CAF1 catalytic site fully accessible to RNA substrates.
22683897 N-terminus played a role in modulating hCaf1 activity, stability and aggregation
21336257 Together, these results indicate that Tob mediates the recruitment of Caf1 to the target of CPEB3 and elicits deadenylation and decay of the mRNA.
20595394 Tob interactions with Caf1 and a C-terminal domain of PABPC1
20595389 MK2 phosphorylation reduces the ability of TTP to promote deadenylation by inhibiting the recruitment of CAF1 deadenylase in a mechanism that does not involve sequestration of TTP by 14-3-3.
More...

AA Sequence

MPAALVENSQVICEVWASNLEEEMRKIREIVLSYSYIAMDTEFPGVVVRPIGEFRSSIDYQYQLLRCNVD      1 - 70
LLKIIQLGLTFTNEKGEYPSGINTWQFNFKFNLTEDMYSQDSIDLLANSGLQFQKHEEEGIDTLHFAELL     71 - 140
MTSGVVLCDNVKWLSFHSGYDFGYMVKLLTDSRLPEEEHEFFHILNLFFPSIYDVKYLMKSCKNLKGGLQ    141 - 210
EVADQLDLQRIGRQHQAGSDSLLTGMAFFRMKELFFEDSIDDAKYCGRLYGLGTGVAQKQNEDVDSAQEK    211 - 280
MSILAIINNMQQ                                                              281 - 292
//

Text Mined References (38)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25944446 2015 The enzyme activities of Caf1 and Ccr4 are both required for deadenylation by the human Ccr4-Not nuclease module.
25416956 2014 A proteome-scale map of the human interactome network.
25038453 2014 CNOT7/hCAF1 is involved in ICAM-1 and IL-8 regulation by tristetraprolin.
24115769 2013 The SMG5-SMG7 heterodimer directly recruits the CCR4-NOT deadenylase complex to mRNAs containing nonsense codons via interaction with POP2.
24036545 2013 Human CAF-1-dependent nucleosome assembly in a defined system.
23236473 2012 The anti-proliferative activity of BTG/TOB proteins is mediated via the Caf1a (CNOT7) and Caf1b (CNOT8) deadenylase subunits of the Ccr4-not complex.
22977175 2012 The structural basis for the interaction between the CAF1 nuclease and the NOT1 scaffold of the human CCR4-NOT deadenylase complex.
22683897 2012 The N-terminus modulates human Caf1 activity, structural stability and aggregation.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
More...