Property Summary

NCBI Gene PubMed Count 37
PubMed Score 687.50
PubTator Score 2175.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
aldosterone-producing adenoma -1.066 4.7e-02
atypical teratoid/rhabdoid tumor 1.100 8.8e-04
group 4 medulloblastoma 1.500 1.4e-03
lung adenocarcinoma 1.212 1.9e-06
medulloblastoma, large-cell 1.200 4.4e-06
osteosarcoma -1.626 7.0e-05
pituitary cancer 1.100 1.7e-06
tuberculosis and treatment for 6 months 1.100 3.6e-04

Gene RIF (14)

AA Sequence

MPAALVENSQVICEVWASNLEEEMRKIREIVLSYSYIAMDTEFPGVVVRPIGEFRSSIDYQYQLLRCNVD      1 - 70
LLKIIQLGLTFTNEKGEYPSGINTWQFNFKFNLTEDMYSQDSIDLLANSGLQFQKHEEEGIDTLHFAELL     71 - 140
MTSGVVLCDNVKWLSFHSGYDFGYMVKLLTDSRLPEEEHEFFHILNLFFPSIYDVKYLMKSCKNLKGGLQ    141 - 210
EVADQLDLQRIGRQHQAGSDSLLTGMAFFRMKELFFEDSIDDAKYCGRLYGLGTGVAQKQNEDVDSAQEK    211 - 280
MSILAIINNMQQ                                                              281 - 292
//

Text Mined References (39)

PMID Year Title