Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.06

Knowledge Summary

Patent

No data available

Synonym

Accession Q9UEU5 A6NG46 A6NNR8 B7ZL76 Q4V325 GAGE-2D
Symbols CT4.8
GAGE8
GAGE-8
GAGE-2D

Gene

 GO Process (1)

 Compartment GO Term (1)

AA Sequence

MSWRGRSTYRPRPRRYVEPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPK      1 - 70
PEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC                             71 - 116
//

Text Mined References (7)

PMID Year Title