Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.06

Knowledge Summary

Patent

No data available

Synonym

Accession Q9UEU5 A6NG46 A6NNR8 B7ZL76 Q4V325 GAGE-2D
Symbols CT4.8
GAGE8
GAGE-8
GAGE-2D

Gene

 GO Process (1)

 Compartment GO Term (1)

AA Sequence

MSWRGRSTYRPRPRRYVEPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPK      1 - 70
PEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC                             71 - 116
//

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
18179644 2008 An overview of the GAGE cancer/testis antigen family with the inclusion of newly identified members.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10397259 1999 Characterization of the GAGE genes that are expressed in various human cancers and in normal testis.