Property Summary

NCBI Gene PubMed Count 25
Grant Count 83
R01 Count 71
Funding $7,326,832.24
PubMed Score 59.84
PubTator Score 86.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Synonym

Accession Q9UEU0 O43547 Q96J28
Symbols VTI1
VTI2
VTI1L
v-SNARE
vti1-rp1
VTI1-LIKE

Gene

PDB

2V8S  

Gene RIF (7)

PMID Text
22875976 HIV-1 Gag co-localizes with the endosomal SNARE proteins Vti1b and syntaxin 8 in HPS2 fibroblasts
21562157 Vti1b-dependent tethering of Lytic granule and CD3-endo determines accumulation, docking, and efficient lytic granule secretion at the immunological synapse.
20089838 Results suggest that the combinational SNARE proteins VAMP8 and Vti1b mediate the fusion of antimicrobial and canonical autophagosomes with lysosomes, an essential event for autophagic degradation.
18570918 Results report that syntaxin 7, syntaxin 8, vti1b and VAMP8 physically and functionally interact with CFTR.
15371541 epsin 4 epsin-related protein is an adaptor for vti1b
14769786 Ca(2+) dissociates the Hrs-containing complex but not the VAMP-2-containing SNARE complex
12853575 A dual mechanism controlling the localization and function of exocytic v-SNAREs.

AA Sequence

MASSAASSEHFEKLHEIFRGLHEDLQGVPERLLGTAGTEEKKKLIRDFDEKQQEANETLAEMEEELRYAP      1 - 70
LSFRNPMMSKLRNYRKDLAKLHREVRSTPLTATPGGRGDMKYGIYAVENEHMNRLQSQRAMLLQGTESLN     71 - 140
RATQSIERSHRIATETDQIGSEIIEELGEQRDQLERTKSRLVNTSENLSKSRKILRSMSRKVTTNKLLLS    141 - 210
IIILLELAILGGLVYYKFFRSH                                                    211 - 232
//

Text Mined References (33)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24550300 2014 UVRAG is required for virus entry through combinatorial interaction with the class C-Vps complex and SNAREs.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23217709 2012 The hairpin-type tail-anchored SNARE syntaxin 17 targets to autophagosomes for fusion with endosomes/lysosomes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21562157 2011 Docking of lytic granules at the immunological synapse in human CTL requires Vti1b-dependent pairing with CD3 endosomes.
21516116 2011 Next-generation sequencing to generate interactome datasets.
More...