Property Summary

NCBI Gene PubMed Count 246
Grant Count 219
R01 Count 119
Funding $26,280,413.47
PubMed Score 698.94
PubTator Score 440.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
group 4 medulloblastoma 4.300 0.000
non-small cell lung cancer -1.957 0.000
lung cancer -1.200 0.000
cystic fibrosis -1.700 0.000
lung adenocarcinoma -2.400 0.000
ductal carcinoma in situ -1.800 0.000
invasive ductal carcinoma -2.100 0.000
pituitary cancer 1.700 0.000

Synonym

Accession Q9UEF7 Q5VZ95 Q96KV5 Q96KW5 Q9UEI9 Q9Y4F0
Symbols

Gene

KL

PANTHER Protein Class (2)

Gene RIF (248)

PMID Text
26880028 The -395A allele carriers of the Klotho gene were correlated with lower risk of metabolic syndrome in a Chinese elderly population.
26732817 KLOTHO G-395A polymorphism associates with reduced cognitive impairment in a sample of Chinese nonagenarians and centenarians.
26665756 No association was found between multiple kidney stones and polymorphisms of genes encoding KL, VDR, CASR.
26634510 The -395A allele of the KLOTHO gene may be a protective genetic factor for hypertension in the Chinese population.
26607681 The data suggest that secreted Klotho protein attenuates the osteogenic differentiation of human bone marrow mesenchymal stem cells in vitro through FGFR1/ERK signaling.
26601789 Data suggest that down-regulation of serum Klotho level may play role in development of atherosclerosis and endothelial dysfunction in subjects with type 1 diabetes.
26531219 Data revealed the existence of a moderating effect between Klotho and STC1, where Klotho may inhibit thyroid tumor progression by inhibiting the tumor marker level of STC1.
26499380 Lower expression of Klotho is associated with liver cancer.
26462468 serum sKlotho levels inversely correlated with age and FGF23, and were significantly reduced in patients with osteoporosis. sKlotho may serve as a biomarker of aging independent of renal function
26460265 The preliminary investigation into the correlation between markers of osteo- and sarcopenia and Klotho demonstrated a decreased Klotho concentration in beta-TM patients and a higher probability of having had fragility fractures.
More...

AA Sequence

MPASAPPRRPRPPPPSLSLLLVLLGLGGRRLRAEPGDGAQTWARFSRPPAPEAAGLFQGTFPDGFLWAVG      1 - 70
SAAYQTEGGWQQHGKGASIWDTFTHHPLAPPGDSRNASLPLGAPSPLQPATGDVASDSYNNVFRDTEALR     71 - 140
ELGVTHYRFSISWARVLPNGSAGVPNREGLRYYRRLLERLRELGVQPVVTLYHWDLPQRLQDAYGGWANR    141 - 210
ALADHFRDYAELCFRHFGGQVKYWITIDNPYVVAWHGYATGRLAPGIRGSPRLGYLVAHNLLLAHAKVWH    211 - 280
LYNTSFRPTQGGQVSIALSSHWINPRRMTDHSIKECQKSLDFVLGWFAKPVFIDGDYPESMKNNLSSILP    281 - 350
DFTESEKKFIKGTADFFALCFGPTLSFQLLDPHMKFRQLESPNLRQLLSWIDLEFNHPQIFIVENGWFVS    351 - 420
GTTKRDDAKYMYYLKKFIMETLKAIKLDGVDVIGYTAWSLMDGFEWHRGYSIRRGLFYVDFLSQDKMLLP    421 - 490
KSSALFYQKLIEKNGFPPLPENQPLEGTFPCDFAWGVVDNYIQVDTTLSQFTDLNVYLWDVHHSKRLIKV    491 - 560
DGVVTKKRKSYCVDFAAIQPQIALLQEMHVTHFRFSLDWALILPLGNQSQVNHTILQYYRCMASELVRVN    561 - 630
ITPVVALWQPMAPNQGLPRLLARQGAWENPYTALAFAEYARLCFQELGHHVKLWITMNEPYTRNMTYSAG    631 - 700
HNLLKAHALAWHVYNEKFRHAQNGKISIALQADWIEPACPFSQKDKEVAERVLEFDIGWLAEPIFGSGDY    701 - 770
PWVMRDWLNQRNNFLLPYFTEDEKKLIQGTFDFLALSHYTTILVDSEKEDPIKYNDYLEVQEMTDITWLN    771 - 840
SPSQVAVVPWGLRKVLNWLKFKYGDLPMYIISNGIDDGLHAEDDQLRVYYMQNYINEALKAHILDGINLC    841 - 910
GYFAYSFNDRTAPRFGLYRYAADQFEPKASMKHYRKIIDSNGFPGPETLERFCPEEFTVCTECSFFHTRK    911 - 980
SLLAFIAFLFFASIISLSLIFYYSKKGRRSYK                                          981 - 1012
//

Text Mined References (247)

PMID Year Title
26880028 2016 The Klotho gene G-395A polymorphism and metabolic syndrome in very elderly people.
26732817 2016 G-395A polymorphism in the promoter region of the KLOTHO gene associates with reduced cognitive impairment among the oldest old.
26665756 [GENETIC RISK FACTORS FOR MULTIPLE KIDNEY STONE FORMATION IN THE RUSSIAN POPULATION].
26634510 2015 G-395A polymorphism in the promoter region of the KLOTHO gene and hypertension among elderly (90 years and older) Chinese individuals.
26607681 2015 Secreted klotho protein attenuates osteogenic differentiation of human bone marrow mesenchymal stem cells in vitro via inactivation of the FGFR1/ERK signaling pathway.
26601789 Is serum Klotho protective against atherosclerosis in patients with type 1 diabetes mellitus?
26531219 2016 Klotho inhibits human follicular thyroid cancer cell growth and promotes apoptosis through regulation of the expression of stanniocalcin-1.
26499380 2015 Overexpression of Klotho suppresses liver cancer progression and induces cell apoptosis by negatively regulating wnt/?-catenin signaling pathway.
26462468 2015 Soluble ?Klotho as a candidate for the biomarker of aging.
26460265 2015 Klotho, a new marker for osteoporosis and muscle strength in ?-thalassemia major.
More...