Property Summary

NCBI Gene PubMed Count 75
PubMed Score 157.26
PubTator Score 92.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Nephrosis 21 0.0 1.1
Refractive error 50 0.0 3.0
Disease Target Count Z-score Confidence
Nonsyndromic deafness 142 0.0 5.0
Disease Target Count Z-score Confidence
Cholestasis 155 3.579 1.8
Wernicke encephalopathy 12 3.291 1.6

Expression

  Differential Expression (23)

Disease log2 FC p
Amyotrophic lateral sclerosis 1.142 3.1e-06
astrocytic glioma 2.000 4.8e-02
dermatomyositis 1.900 2.0e-04
Down syndrome 2.200 5.7e-04
group 3 medulloblastoma -1.400 2.2e-02
interstitial cystitis -1.100 1.1e-03
intraductal papillary-mucinous adenoma (... 1.300 3.6e-03
intraductal papillary-mucinous carcinoma... 1.400 1.0e-02
intraductal papillary-mucinous neoplasm ... 1.800 6.6e-03
juvenile dermatomyositis 1.199 1.4e-09
lung adenocarcinoma -1.100 9.2e-17
medulloblastoma, large-cell -2.600 2.5e-04
non primary Sjogren syndrome sicca -1.100 1.8e-02
non-small cell lung cancer -1.126 7.5e-09
oligodendroglioma 2.000 3.9e-02
osteosarcoma 1.113 2.1e-03
ovarian cancer -2.300 3.1e-07
Pick disease 1.200 1.7e-03
pituitary cancer -1.600 8.3e-05
primary pancreatic ductal adenocarcinoma 1.446 3.8e-02
psoriasis 1.800 7.2e-05
spina bifida -2.071 3.6e-02
subependymal giant cell astrocytoma -2.661 3.7e-02

Protein-protein Interaction (1)

Gene RIF (33)

AA Sequence

MPVRGDRGFPPRRELSGWLRAPGMEELIWEQYTVTLQKDSKRGFGIAVSGGRDNPHFENGETSIVISDVL      1 - 70
PGGPADGLLQENDRVVMVNGTPMEDVLHSFAVQQLRKSGKVAAIVVKRPRKVQVAALQASPPLDQDDRAF     71 - 140
EVMDEFDGRSFRSGYSERSRLNSHGGRSRSWEDSPERGRPHERARSRERDLSRDRSRGRSLERGLDQDHA    141 - 210
RTRDRSRGRSLERGLDHDFGPSRDRDRDRSRGRSIDQDYERAYHRAYDPDYERAYSPEYRRGARHDARSR    211 - 280
GPRSRSREHPHSRSPSPEPRGRPGPIGVLLMKSRANEEYGLRLGSQIFVKEMTRTGLATKDGNLHEGDII    281 - 350
LKINGTVTENMSLTDARKLIEKSRGKLQLVVLRDSQQTLINIPSLNDSDSEIEDISEIESNRSFSPEERR    351 - 420
HQYSDYDYHSSSEKLKERPSSREDTPSRLSRMGATPTPFKSTGDIAGTVVPETNKEPRYQEDPPAPQPKA    421 - 490
APRTFLRPSPEDEAIYGPNTKMVRFKKGDSVGLRLAGGNDVGIFVAGIQEGTSAEQEGLQEGDQILKVNT    491 - 560
QDFRGLVREDAVLYLLEIPKGEMVTILAQSRADVYRDILACGRGDSFFIRSHFECEKETPQSLAFTRGEV    561 - 630
FRVVDTLYDGKLGNWLAVRIGNELEKGLIPNKSRAEQMASVQNAQRDNAGDRADFWRMRGQRSGVKKNLR    631 - 700
KSREDLTAVVSVSTKFPAYERVLLREAGFKRPVVLFGPIADIAMEKLANELPDWFQTAKTEPKDAGSEKS    701 - 770
TGVVRLNTVRQIIEQDKHALLDVTPKAVDLLNYTQWFPIVIFFNPDSRQGVKTMRQRLNPTSNKSSRKLF    771 - 840
DQANKLKKTCAHLFTATINLNSANDSWFGSLKDTIQHQQGEAVWVSEGKMEGMDDDPEDRMSYLTAMGAD    841 - 910
YLSCDSRLISDFEDTDGEGGAYTDNELDEPAEEPLVSSITRSSEPVQHEESIRKPSPEPRAQMRRAASSD    911 - 980
QLRDNSPPPAFKPEPPKAKTQNKEESYDFSKSYEYKSNPSAVAGNETPGASTKGYPPPVAAKPTFGRSIL    981 - 1050
KPSTPIPPQEGEEVGESSEEQDNAPKSVLGKVKIFEKMDHKARLQRMQELQEAQNARIEIAQKHPDIYAV   1051 - 1120
PIKTHKPDPGTPQHTSSRPPEPQKAPSRPYQDTRGSYGSDAEEEEYRQQLSEHSKRGYYGQSARYRDTEL   1121 - 1190
//

Text Mined References (86)

PMID Year Title