Property Summary

NCBI Gene PubMed Count 70
Grant Count 70
R01 Count 46
Funding $4,131,217.37
PubMed Score 142.59
PubTator Score 92.39

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9UDY2 A2A3H9 B7Z2R8 B7Z7T6 F5H301 F5H886 Q15883 Q5VXL0 Q5VXL1 Q8N756 Q8NI14 Q99839 Q9UDY0 Q9UDY1
Symbols ZO2
X104
PFIC4
DFNA51
DUP9q21.11
C9DUPq21.11

Gene

PANTHER Protein Class (2)

PDB

2OSG   3E17  

Gene RIF (30)

PMID Text
25712527 Claudin-19, the most abundant claudin in myelin, exhibited no binding to ZO2.
24660027 Exposure of brain micro vascular endothelial cells to HIV-1 Tat results in a decrease of claudin-1, claudin-5, and zonula occludens-2 expression and cellular redistribution of claudin-5, suggesting potential disturbance of the blood-brain barrier by Tat
24614073 Protein-truncating mutations in the tight junction protein 2 gene cause failure of protein localization and disruption of tight-junction structure, leading to severe cholestatic liver disease.
23885123 JAM-A regulates epithelial permeability via association with ZO-2, afadin, and PDZ-GEF1 to activate Rap2c and control contraction of the apical cytoskeleton.
23612256 the Alu-related transcript of TJP2 gene (TJP2-Alu transcript) was differentially expressed between colorectal tumor and normal tissues; potential diagnostic markers for colorectal cancer.
23605953 demonstrated that ZO-2 inhibition increases invasive and migrative capacities of invasive tumor cells. This was associated with an increase of MT1-MMP
22671599 ZO-2 inhibits the Wnt signaling pathway, reduces cell proliferation, and promotes apoptosis; its absence, mutation, or overexpression is present in various human diseases, including deafness and cancer.
22591361 Exposure of brain micro vascular endothelial cells to HIV-1 Tat results in a decrease of claudin-1, claudin-5, and zonula occludens-2 expression and cellular redistribution of claudin-5, suggesting potential disturbance of the blood-brain barrier by Tat
21685940 AmotL1 and ZO-2 are two candidates that could be harnessed to control the oncogenic function of YAP.
21679692 these findings imply involvement of the ZO-2 tight junction independent signaling complex containing Jak1 and uPAR in VSMC intercellular communications.
More...

AA Sequence

MPVRGDRGFPPRRELSGWLRAPGMEELIWEQYTVTLQKDSKRGFGIAVSGGRDNPHFENGETSIVISDVL      1 - 70
PGGPADGLLQENDRVVMVNGTPMEDVLHSFAVQQLRKSGKVAAIVVKRPRKVQVAALQASPPLDQDDRAF     71 - 140
EVMDEFDGRSFRSGYSERSRLNSHGGRSRSWEDSPERGRPHERARSRERDLSRDRSRGRSLERGLDQDHA    141 - 210
RTRDRSRGRSLERGLDHDFGPSRDRDRDRSRGRSIDQDYERAYHRAYDPDYERAYSPEYRRGARHDARSR    211 - 280
GPRSRSREHPHSRSPSPEPRGRPGPIGVLLMKSRANEEYGLRLGSQIFVKEMTRTGLATKDGNLHEGDII    281 - 350
LKINGTVTENMSLTDARKLIEKSRGKLQLVVLRDSQQTLINIPSLNDSDSEIEDISEIESNRSFSPEERR    351 - 420
HQYSDYDYHSSSEKLKERPSSREDTPSRLSRMGATPTPFKSTGDIAGTVVPETNKEPRYQEDPPAPQPKA    421 - 490
APRTFLRPSPEDEAIYGPNTKMVRFKKGDSVGLRLAGGNDVGIFVAGIQEGTSAEQEGLQEGDQILKVNT    491 - 560
QDFRGLVREDAVLYLLEIPKGEMVTILAQSRADVYRDILACGRGDSFFIRSHFECEKETPQSLAFTRGEV    561 - 630
FRVVDTLYDGKLGNWLAVRIGNELEKGLIPNKSRAEQMASVQNAQRDNAGDRADFWRMRGQRSGVKKNLR    631 - 700
KSREDLTAVVSVSTKFPAYERVLLREAGFKRPVVLFGPIADIAMEKLANELPDWFQTAKTEPKDAGSEKS    701 - 770
TGVVRLNTVRQIIEQDKHALLDVTPKAVDLLNYTQWFPIVIFFNPDSRQGVKTMRQRLNPTSNKSSRKLF    771 - 840
DQANKLKKTCAHLFTATINLNSANDSWFGSLKDTIQHQQGEAVWVSEGKMEGMDDDPEDRMSYLTAMGAD    841 - 910
YLSCDSRLISDFEDTDGEGGAYTDNELDEPAEEPLVSSITRSSEPVQHEESIRKPSPEPRAQMRRAASSD    911 - 980
QLRDNSPPPAFKPEPPKAKTQNKEESYDFSKSYEYKSNPSAVAGNETPGASTKGYPPPVAAKPTFGRSIL    981 - 1050
KPSTPIPPQEGEEVGESSEEQDNAPKSVLGKVKIFEKMDHKARLQRMQELQEAQNARIEIAQKHPDIYAV   1051 - 1120
PIKTHKPDPGTPQHTSSRPPEPQKAPSRPYQDTRGSYGSDAEEEEYRQQLSEHSKRGYYGQSARYRDTEL   1121 - 1190
//

Text Mined References (81)

PMID Year Title
25712527 2015 Biophysical characterization of interactions between the C-termini of peripheral nerve claudins and the PDZ? domain of zonula occludens.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24614073 2014 Mutations in TJP2 cause progressive cholestatic liver disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23885123 2013 JAM-A associates with ZO-2, afadin, and PDZ-GEF1 to activate Rap2c and regulate epithelial barrier function.
23612256 2013 Alu-related transcript of TJP2 gene as a marker for colorectal cancer.
23605953 2013 Regulation of membrane-type 1 matrix metalloproteinase expression by zonula occludens-2 in human lung cancer cells.
23396134 2013 Genome-wide meta-analyses of multiancestry cohorts identify multiple new susceptibility loci for refractive error and myopia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22671599 2012 ZO-2, a tight junction scaffold protein involved in the regulation of cell proliferation and apoptosis.
More...