Property Summary

NCBI Gene PubMed Count 9
PubMed Score 11.74
PubTator Score 6.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 5.25523225845787E-25
lung carcinoma 2844 6.7857532174279E-15
lung adenocarcinoma 2714 7.57740289327479E-12
non-small cell lung cancer 2798 9.76142581918917E-12
osteosarcoma 7933 5.96771056723144E-9
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00167077458408126
mucosa-associated lymphoid tissue lymphoma 480 0.0318757600245337

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -4.516 0.000
pancreatic ductal adenocarcinoma liver m... -2.111 0.002
non-small cell lung cancer -1.595 0.000
lung adenocarcinoma -1.200 0.000
lung carcinoma -1.400 0.000
mucosa-associated lymphoid tissue lympho... 1.060 0.032
psoriasis -2.300 0.000

Synonym

Accession Q9UDX3 A5D6W7 A6NCV4
Symbols TAP3

Gene

PANTHER Protein Class (1)

PDB

4TLG  

  Ortholog (4)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat EggNOG Inparanoid

Gene RIF (2)

PMID Text
20012369 The isolation of an alternatively spliced hTAP3 cDNA and a polymorphism within the coding region of the hTAP3/SEC14L4 gene, is reported.
15033454 Discusses cloning of rat SEC14-like protein 3 and mentions three human SPF-related genes, known as SEC14-like protein 1, 2 and 3.

AA Sequence

MSSRVGDLSPQQQEALARFRENLQDLLPILPNADDYFLLRWLRARNFDLQKSEDMLRRHMEFRKQQDLDN      1 - 70
IVTWQPPEVIQLYDSGGLCGYDYEGCPVYFNIIGSLDPKGLLLSASKQDMIRKRIKVCELLLHECELQTQ     71 - 140
KLGRKIEMALMVFDMEGLSLKHLWKPAVEVYQQFFSILEANYPETLKNLIVIRAPKLFPVAFNLVKSFMS    141 - 210
EETRRKIVILGDNWKQELTKFISPDQLPVEFGGTMTDPDGNPKCLTKINYGGEVPKSYYLCEQVRLQYEH    211 - 280
TRSVGRGSSLQVENEILFPGCVLRWQFASDGGDIGFGVFLKTKMGEQQSAREMTEVLPSQRYNAHMVPED    281 - 350
GSLTCLQAGVYVLRFDNTYSRMHAKKLSYTVEVLLPDKASEETLQSLKAMRPSPTQ                  351 - 406
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
20012369 2010 Alternative splicing and gene polymorphism of the human TAP3/SEC14L4 gene.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15033454 2004 Rat supernatant protein factor-like protein stimulates squalene monooxygenase and is activated by protein kinase A.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12757856 2003 Cloning of novel human SEC14p-like proteins: ligand binding and functional properties.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.
More...