Property Summary

NCBI Gene PubMed Count 9
PubMed Score 13.08
PubTator Score 6.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
lung adenocarcinoma -1.200 7.6e-12
lung carcinoma -1.400 6.8e-15
mucosa-associated lymphoid tissue lympho... 1.060 3.2e-02
non-small cell lung cancer -1.595 9.8e-12
osteosarcoma -4.516 6.0e-09
pancreatic ductal adenocarcinoma liver m... -2.111 1.7e-03
psoriasis -2.300 5.3e-25

Gene RIF (2)

AA Sequence

MSSRVGDLSPQQQEALARFRENLQDLLPILPNADDYFLLRWLRARNFDLQKSEDMLRRHMEFRKQQDLDN      1 - 70
IVTWQPPEVIQLYDSGGLCGYDYEGCPVYFNIIGSLDPKGLLLSASKQDMIRKRIKVCELLLHECELQTQ     71 - 140
KLGRKIEMALMVFDMEGLSLKHLWKPAVEVYQQFFSILEANYPETLKNLIVIRAPKLFPVAFNLVKSFMS    141 - 210
EETRRKIVILGDNWKQELTKFISPDQLPVEFGGTMTDPDGNPKCLTKINYGGEVPKSYYLCEQVRLQYEH    211 - 280
TRSVGRGSSLQVENEILFPGCVLRWQFASDGGDIGFGVFLKTKMGEQQSAREMTEVLPSQRYNAHMVPED    281 - 350
GSLTCLQAGVYVLRFDNTYSRMHAKKLSYTVEVLLPDKASEETLQSLKAMRPSPTQ                  351 - 406
//

Text Mined References (11)

PMID Year Title