Property Summary

NCBI Gene PubMed Count 9
PubMed Score 11.74
PubTator Score 6.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -4.516 0.000
pancreatic ductal adenocarcinoma liver m... -2.111 0.002
non-small cell lung cancer -1.595 0.000
lung adenocarcinoma -1.200 0.000
lung carcinoma -1.400 0.000
mucosa-associated lymphoid tissue lympho... 1.060 0.032
psoriasis -2.300 0.000

Gene RIF (2)

PMID Text
20012369 The isolation of an alternatively spliced hTAP3 cDNA and a polymorphism within the coding region of the hTAP3/SEC14L4 gene, is reported.
15033454 Discusses cloning of rat SEC14-like protein 3 and mentions three human SPF-related genes, known as SEC14-like protein 1, 2 and 3.

AA Sequence

MSSRVGDLSPQQQEALARFRENLQDLLPILPNADDYFLLRWLRARNFDLQKSEDMLRRHMEFRKQQDLDN      1 - 70
IVTWQPPEVIQLYDSGGLCGYDYEGCPVYFNIIGSLDPKGLLLSASKQDMIRKRIKVCELLLHECELQTQ     71 - 140
KLGRKIEMALMVFDMEGLSLKHLWKPAVEVYQQFFSILEANYPETLKNLIVIRAPKLFPVAFNLVKSFMS    141 - 210
EETRRKIVILGDNWKQELTKFISPDQLPVEFGGTMTDPDGNPKCLTKINYGGEVPKSYYLCEQVRLQYEH    211 - 280
TRSVGRGSSLQVENEILFPGCVLRWQFASDGGDIGFGVFLKTKMGEQQSAREMTEVLPSQRYNAHMVPED    281 - 350
GSLTCLQAGVYVLRFDNTYSRMHAKKLSYTVEVLLPDKASEETLQSLKAMRPSPTQ                  351 - 406
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
20012369 2010 Alternative splicing and gene polymorphism of the human TAP3/SEC14L4 gene.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15033454 2004 Rat supernatant protein factor-like protein stimulates squalene monooxygenase and is activated by protein kinase A.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12757856 2003 Cloning of novel human SEC14p-like proteins: ligand binding and functional properties.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.
More...