Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.68
PubTator Score 7.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
medulloblastoma 1524 5.76112388301093E-6
glioblastoma 5572 6.675718977899E-5
medulloblastoma, large-cell 6234 2.27685502358696E-4
Disease Target Count Z-score Confidence
Adult T-cell leukemia 5 3.156 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
glioblastoma 1.100 0.000
medulloblastoma 1.200 0.000
medulloblastoma, large-cell 1.100 0.000

Synonym

Accession Q9UDV7 B4DRI5 O43691 Q6DKK0
Symbols HUB1

Gene

  Ortholog (5)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (3)

PMID Text
25373738 ZNF282 is E2F1 co-activator involved in esophageal squamous cell carcinoma
22986521 SUMOylation of ZFP282 potentiates its positive effect on estrogen signaling in breast tumorigenesis.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MQFVSTRPQPQQLGIQGLGLDSGSWSWAQALPPEEVCHQEPALRGEMAEGMPPMQAQEWDMDARRPMPFQ      1 - 70
FPPFPDRAPVFPDRMMREPQLPTAEISLWTVVAAIQAVERKVDAQASQLLNLEGRTGTAEKKLADCEKTA     71 - 140
VEFGNHMESKWAVLGTLLQEYGLLQRRLENLENLLRNRNFWVLRLPPGSKGEAPKVPVTFVDIAVYFSED    141 - 210
EWKNLDEWQKELYNNLVKENYKTLMSLDAEGSVPKPDAPVQAEPREEPCVWEQRHPEEREIPMDPEAGAE    211 - 280
PLVPAQDASSQVKREDTLCVRGQRGLEERAIPTESITDSPISAQDLLSRIKQEEHQCVWDQQDLADRDIP    281 - 350
TDPNSESLISAHDILSWIKQEEQPYPWGPRDSMDGELGLDSGPSDSLLMVKNPPPAPPQPQPQPQPPQPQ    351 - 420
LQSQPQPQSLPPIAVAENPGGPPSRGLLDDGFQVLPGERGSGEAPPGGDRSTGGGGGDGGGGGGGAEAGT    421 - 490
GAGGGCGSCCPGGLRRSLLLHGARSKPYSCPECGKSFGVRKSLIIHHRSHTKERPYECAECEKSFNCHSG    491 - 560
LIRHQMTHRGERPYKCSECEKTYSRKEHLQNHQRLHTGERPFQCALCGKSFIRKQNLLKHQRIHTGERPY    561 - 630
TCGECGKSFRYKESLKDHLRVHSGGPGPGAPRQLPPPPERD                                 631 - 671
//

Text Mined References (13)

PMID Year Title
25373738 2014 ZNF282 (Zinc finger protein 282), a novel E2F1 co-activator, promotes esophageal squamous cell carcinoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22986521 2013 SUMOylation of ZFP282 potentiates its positive effect on estrogen signaling in breast tumorigenesis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15790807 2005 Transcriptional maps of 10 human chromosomes at 5-nucleotide resolution.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...