Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.68
PubTator Score 7.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
medulloblastoma 720 5.8e-06
glioblastoma 5792 6.7e-05
medulloblastoma, large-cell 6241 2.3e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Adult T-cell leukemia 5 3.177 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
glioblastoma 1.100 6.7e-05
medulloblastoma 1.200 5.8e-06
medulloblastoma, large-cell 1.100 2.3e-04

Gene RIF (3)

AA Sequence

MQFVSTRPQPQQLGIQGLGLDSGSWSWAQALPPEEVCHQEPALRGEMAEGMPPMQAQEWDMDARRPMPFQ      1 - 70
FPPFPDRAPVFPDRMMREPQLPTAEISLWTVVAAIQAVERKVDAQASQLLNLEGRTGTAEKKLADCEKTA     71 - 140
VEFGNHMESKWAVLGTLLQEYGLLQRRLENLENLLRNRNFWVLRLPPGSKGEAPKVPVTFVDIAVYFSED    141 - 210
EWKNLDEWQKELYNNLVKENYKTLMSLDAEGSVPKPDAPVQAEPREEPCVWEQRHPEEREIPMDPEAGAE    211 - 280
PLVPAQDASSQVKREDTLCVRGQRGLEERAIPTESITDSPISAQDLLSRIKQEEHQCVWDQQDLADRDIP    281 - 350
TDPNSESLISAHDILSWIKQEEQPYPWGPRDSMDGELGLDSGPSDSLLMVKNPPPAPPQPQPQPQPPQPQ    351 - 420
LQSQPQPQSLPPIAVAENPGGPPSRGLLDDGFQVLPGERGSGEAPPGGDRSTGGGGGDGGGGGGGAEAGT    421 - 490
GAGGGCGSCCPGGLRRSLLLHGARSKPYSCPECGKSFGVRKSLIIHHRSHTKERPYECAECEKSFNCHSG    491 - 560
LIRHQMTHRGERPYKCSECEKTYSRKEHLQNHQRLHTGERPFQCALCGKSFIRKQNLLKHQRIHTGERPY    561 - 630
TCGECGKSFRYKESLKDHLRVHSGGPGPGAPRQLPPPPERD                                 631 - 671
//

Text Mined References (14)

PMID Year Title