Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MALPTPSDSTLPAEARGRGRRRRLVWTPSQSEALRACFERNPYPGIATRERLAQAIGIPEPRVQIWFQNE      1 - 70
RSRQLRQHRRESRPWPGRRGPPEGRRKRTAVTGSQTALLLRAFEKDRFPGIAAREELARETGLPESRIQI     71 - 140
WFQNRRARHPGQGGRAPAQAGGLCSAAPGGGHPAPSWVAFAHTGAWGTGLPAPHVPCAPGALPQGAFVSQ    141 - 210
AARAAPALQPSQAAPAEGISQPAPARGDFAYAAPAPPDGALSHPQAPRWPPHPGKSREDRDPQRDGLPGP    211 - 280
CAVAQPGPAQAGPQGQGVLAPPTSQGSPWWGWGRGPQVAGAAWEPQAGAAPPPQPAPPDASASARQGQMQ    281 - 350
GIPAPSQALQEPAPWSALPCGLLLDELLASPEFLQQAQPLLETEAPGELEASEEAASLEAPLSEEEYRAL    351 - 420
LEEL                                                                      421 - 424
//

Text Mined References (6)

PMID Year Title
24145033 2013 Defective regulation of microRNA target genes in myoblasts from facioscapulohumeral dystrophy patients.
21060811 2010 Facioscapulohumeral dystrophy: incomplete suppression of a retrotransposed gene.
19320656 2009 Facioscapulohumeral muscular dystrophy: epidemiological and molecular study in a north-east Italian population sample.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15709750 2005 Intracellular trafficking and dynamics of double homeodomain proteins.
10433963 1999 Nucleotide sequence of the partially deleted D4Z4 locus in a patient with FSHD identifies a putative gene within each 3.3 kb element.