Property Summary

NCBI Gene PubMed Count 48
Grant Count 24
R01 Count 7
Funding $3,942,581.85
PubMed Score 100.36
PubTator Score 61.17

Knowledge Summary

Patent

No data available

Expression

Gene RIF (32)

PMID Text
26471130 The SEL1L critically regulates HRD1-mediated disposal of misfolded cargo through its short membrane spanning stretch.
25948789 this is the first study reporting a significant association of the SEL1L SNP rs12435998 constitutive genetic variant with an improved overall survival in glioblastoma multiforme patients
24324549 Data revealed close interaction of these two proteins in regulating the cross-talk between extracellular matrix and insulin signalling to create a favourable micro-environment for ss-cell development and function.
24311781 SEL1L down-modulation synergy enhances valporic acid cytotoxic effects by influencing glioma stem cells proliferation and self-renewal properties.
24043630 ATF6 represents a novel type of ERAD-Lm substrate requiring SEL1L for degradation despite its transmembrane nature.
23661430 Low expression of SEL1L is associated with pancreatic ductal adenocarcinoma.
23363602 ERdj5, by binding to Sel1L, triggers BiP-Cholera toxin interaction proximal to the Hrd1 complex; postulate this scenario enables the Hrd1-associated retrotranslocation machinery to capture the toxin efficiently once the toxin is released from BiP
22350780 SEL1L expression is a potential colorectal cancer (CRC) tissue biomarker since its expression is significantly higher in adenoma cells with respect to normal mucosa; the levels of expression decrease in undifferentiated CRC cancers
22190034 HIV-1 gp41 is identified to have a physical interaction with sel-1 suppressor of lin-12-like (SEL1L) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22190034 HIV-1 gp41 is identified to have a physical interaction with sel-1 suppressor of lin-12-like (SEL1L) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
More...

AA Sequence

MRVRIGLTLLLCAVLLSLASASSDEEGSQDESLDSKTTLTSDESVKDHTTAGRVVAGQIFLDSEESELES      1 - 70
SIQEEEDSLKSQEGESVTEDISFLESPNPENKDYEEPKKVRKPALTAIEGTAHGEPCHFPFLFLDKEYDE     71 - 140
CTSDGREDGRLWCATTYDYKADEKWGFCETEEEAAKRRQMQEAEMMYQTGMKILNGSNKKSQKREAYRYL    141 - 210
QKAASMNHTKALERVSYALLFGDYLPQNIQAAREMFEKLTEEGSPKGQTALGFLYASGLGVNSSQAKALV    211 - 280
YYTFGALGGNLIAHMVLGYRYWAGIGVLQSCESALTHYRLVANHVASDISLTGGSVVQRIRLPDEVENPG    281 - 350
MNSGMLEEDLIQYYQFLAEKGDVQAQVGLGQLHLHGGRGVEQNHQRAFDYFNLAANAGNSHAMAFLGKMY    351 - 420
SEGSDIVPQSNETALHYFKKAADMGNPVGQSGLGMAYLYGRGVQVNYDLALKYFQKAAEQGWVDGQLQLG    421 - 490
SMYYNGIGVKRDYKQALKYFNLASQGGHILAFYNLAQMHASGTGVMRSCHTAVELFKNVCERGRWSERLM    491 - 560
TAYNSYKDGDYNAAVIQYLLLAEQGYEVAQSNAAFILDQREASIVGENETYPRALLHWNRAASQGYTVAR    561 - 630
IKLGDYHFYGFGTDVDYETAFIHYRLASEQQHSAQAMFNLGYMHEKGLGIKQDIHLAKRFYDMAAEASPD    631 - 700
AQVPVFLALCKLGVVYFLQYIRETNIRDMFTQLDMDQLLGPEWDLYLMTIIALLLGTVIAYRQRQHQDMP    701 - 770
APRPPGPRPAPPQQEGPPEQQPPQ                                                  771 - 794
//

Text Mined References (52)

PMID Year Title
26471130 2016 Association of the SEL1L protein transmembrane domain with HRD1 ubiquitin ligase regulates ERAD-L.
25948789 2015 SEL1L SNP rs12435998, a predictor of glioblastoma survival and response to radio-chemotherapy.
25660456 2015 Identification of ERAD components essential for dislocation of the null Hong Kong variant of ?-1-antitrypsin (NHK).
25066055 2014 The ER-associated degradation adaptor protein Sel1L regulates LPL secretion and lipid metabolism.
24347629 2014 Genome-wide association study of periodontal health measured by probing depth in adults ages 18-49 years.
24324549 2013 SEL1L regulates adhesion, proliferation and secretion of insulin by affecting integrin signaling.
24311781 2014 Down-modulation of SEL1L, an unfolded protein response and endoplasmic reticulum-associated degradation protein, sensitizes glioma stem cells to the cytotoxic effect of valproic acid.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24043630 2013 The unfolded protein response transducer ATF6 represents a novel transmembrane-type endoplasmic reticulum-associated degradation substrate requiring both mannose trimming and SEL1L protein.
23710284 2013 Endoplasmic reticulum stress and Parkinson's disease: the role of HRD1 in averting apoptosis in neurodegenerative disease.
More...