Property Summary

NCBI Gene PubMed Count 50
PubMed Score 84.70
PubTator Score 61.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma -1.200 1.6e-03
atypical teratoid / rhabdoid tumor -1.100 2.2e-04
ependymoma -1.200 4.5e-03
interstitial cystitis 1.100 1.8e-03
intraductal papillary-mucinous adenoma (... -1.700 9.0e-04
intraductal papillary-mucinous carcinoma... -2.000 1.3e-03
intraductal papillary-mucinous neoplasm ... -1.300 3.7e-02
malignant mesothelioma -1.200 2.0e-06
medulloblastoma -1.200 6.4e-06
medulloblastoma, large-cell -1.100 1.2e-03
oligodendroglioma -1.100 3.0e-03
osteosarcoma -1.299 3.4e-05
ovarian cancer -2.100 2.9e-09
pancreatic cancer -1.200 4.0e-03
pancreatic ductal adenocarcinoma liver m... -1.748 1.7e-02
periodontitis 1.100 8.7e-20
psoriasis -2.100 3.4e-05
Rheumatoid arthritis 2.100 5.4e-04

Protein-protein Interaction (2)

Gene RIF (33)

AA Sequence

MRVRIGLTLLLCAVLLSLASASSDEEGSQDESLDSKTTLTSDESVKDHTTAGRVVAGQIFLDSEESELES      1 - 70
SIQEEEDSLKSQEGESVTEDISFLESPNPENKDYEEPKKVRKPALTAIEGTAHGEPCHFPFLFLDKEYDE     71 - 140
CTSDGREDGRLWCATTYDYKADEKWGFCETEEEAAKRRQMQEAEMMYQTGMKILNGSNKKSQKREAYRYL    141 - 210
QKAASMNHTKALERVSYALLFGDYLPQNIQAAREMFEKLTEEGSPKGQTALGFLYASGLGVNSSQAKALV    211 - 280
YYTFGALGGNLIAHMVLGYRYWAGIGVLQSCESALTHYRLVANHVASDISLTGGSVVQRIRLPDEVENPG    281 - 350
MNSGMLEEDLIQYYQFLAEKGDVQAQVGLGQLHLHGGRGVEQNHQRAFDYFNLAANAGNSHAMAFLGKMY    351 - 420
SEGSDIVPQSNETALHYFKKAADMGNPVGQSGLGMAYLYGRGVQVNYDLALKYFQKAAEQGWVDGQLQLG    421 - 490
SMYYNGIGVKRDYKQALKYFNLASQGGHILAFYNLAQMHASGTGVMRSCHTAVELFKNVCERGRWSERLM    491 - 560
TAYNSYKDGDYNAAVIQYLLLAEQGYEVAQSNAAFILDQREASIVGENETYPRALLHWNRAASQGYTVAR    561 - 630
IKLGDYHFYGFGTDVDYETAFIHYRLASEQQHSAQAMFNLGYMHEKGLGIKQDIHLAKRFYDMAAEASPD    631 - 700
AQVPVFLALCKLGVVYFLQYIRETNIRDMFTQLDMDQLLGPEWDLYLMTIIALLLGTVIAYRQRQHQDMP    701 - 770
APRPPGPRPAPPQQEGPPEQQPPQ                                                  771 - 794
//

Text Mined References (54)

PMID Year Title