Property Summary

NCBI Gene PubMed Count 28
PubMed Score 27.42
PubTator Score 26.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
psoriasis 6694 2.1e-59
lung carcinoma 2843 6.8e-08
lung cancer 4740 1.7e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Cleft Soft Palate 7 3.596 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.800 1.7e-04
lung carcinoma 1.700 6.8e-08
psoriasis 3.100 2.1e-59

Protein-protein Interaction (4)

Gene RIF (23)

AA Sequence

MVAAVLLGLSWLCSPLGALVLDFNNIRSSADLHGARKGSQCLSDTDCNTRKFCLQPRDEKPFCATCRGLR      1 - 70
RRCQRDAMCCPGTLCVNDVCTTMEDATPILERQLDEQDGTHAEGTTGHPVQENQPKRKPSIKKSQGRKGQ     71 - 140
EGESCLRTFDCGPGLCCARHFWTKICKPVLLEGQVCSRRGHKDTAQAPEIFQRCDCGPGLLCRSQLTSNR    141 - 210
QHARLRVCQKIEKL                                                            211 - 224
//

Text Mined References (29)

PMID Year Title