Property Summary

NCBI Gene PubMed Count 25
Grant Count 12
R01 Count 6
Funding $1,367,309.16
PubMed Score 23.92
PubTator Score 26.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 5.500 0.000
lung carcinoma 1.700 0.000
psoriasis 3.100 0.000

Gene RIF (20)

PMID Text
26419038 The recurrence of benign tumors of mammary gland occurred predominantly in women-carriers of mutant alleles with polymorphism rs8190924 of gene GSR and AA rs3763511of gene DKK4.
23958302 DKK4 upregulated by T3/TR antagonizes the Wnt signal pathway to suppress tumor cell progression
23516639 rs3923086 in AXIN2 and rs3763511 in DKK4 that did not show any association in the overall population were significantly associated with early on-set and estrogen receptor negative breast cancers, respectively.
23108157 It would appear that deregulation of the WNT pathway by overexpression of DKK4 may further impair WNT signaling and lead to Anorectal malformations.
22740476 Found the unique expression of the Wnt antagonist DKK4 in SW480APC, but not parental SW480 cell-derived exosomes. Upregulation of DKK4 in SW480APC cells was confirmed by RT-PCR, immunoblotting, and immunogold electron microscopy.
22249261 Our findings suggest a potential tumour suppressive role of DKK4 as well as that of an important regulator of HCC.
22216841 TFAP2E hypermethylation is associated with clinical nonresponsiveness to chemotherapy in colorectal cancer. Functional assays confirm that TFAP2E-dependent resistance is mediated through DKK4.
21994129 The TR/DKK4/Wnt/beta-catenin cascade influences the proliferation and migration of hepatoma cells during the metastasis process and support a tumor suppressor role of the thyroid hormone receptor.
21341386 Polymorphism of DKK4 was significantly associated with brain volume in Chinese individuals.
20650998 DKK1 and DKK4 proteins are expressed in the lung epithelium in idiopathic pulmonary fibrosis
More...

AA Sequence

MVAAVLLGLSWLCSPLGALVLDFNNIRSSADLHGARKGSQCLSDTDCNTRKFCLQPRDEKPFCATCRGLR      1 - 70
RRCQRDAMCCPGTLCVNDVCTTMEDATPILERQLDEQDGTHAEGTTGHPVQENQPKRKPSIKKSQGRKGQ     71 - 140
EGESCLRTFDCGPGLCCARHFWTKICKPVLLEGQVCSRRGHKDTAQAPEIFQRCDCGPGLLCRSQLTSNR    141 - 210
QHARLRVCQKIEKL                                                            211 - 224
//

Text Mined References (26)

PMID Year Title
26419038 2015 [MODERN METHODS OF PROGNOSTICATION OF THE RECURRENCES OCCURRENCE AFTER SURGICAL TREATMENT OF THE MAMMARY GLAND BENIGN TUMORS].
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
23958302 2013 Thyroid hormone receptor inhibits hepatoma cell migration through transcriptional activation of Dickkopf 4.
23516639 2013 Association of single nucleotide polymorphisms in Wnt signaling pathway genes with breast cancer in Saudi patients.
23108157 2013 Genome-wide copy number variation study in anorectal malformations.
22740476 2012 Restoration of full-length APC protein in SW480 colon cancer cells induces exosome-mediated secretion of DKK-4.
22249261 2012 Dickkopf 4 (DKK4) acts on Wnt/?-catenin pathway by influencing ?-catenin in hepatocellular carcinoma.
22216841 2012 TFAP2E-DKK4 and chemoresistance in colorectal cancer.
21994129 2012 Dickkopf 4 positively regulated by the thyroid hormone receptor suppresses cell invasion in human hepatoma cells.
21341386 2011 [Association of the schizophrenia susceptible gene DKK4 with brain volume in Chinese populations].
More...