Property Summary

NCBI Gene PubMed Count 35
Grant Count 23
R01 Count 8
Funding $1,166,089.26
PubMed Score 98.23
PubTator Score 101.46

Knowledge Summary

Patent (10,769)

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.100 0.000

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases

Gene RIF (22)

PMID Text
25124033 Degradation of Tiam1 by casein kinase 1 and the SCFbetaTrCP ubiquitin ligase controls the duration of mTOR-S6K signaling.
24469061 discovered that ERBB4 and S6K2 were the direct targets of miR-193a-3p and that PIK3R3 and mTOR were the direct targets of miR-193a-5p in non-small-cell lung cancer
24447338 The amplified luminescent proximity homogeneous assay (AlphaScreen) identifies the interaction of HIV-1 Gag with p70S6Kb
24131622 The mTOR effectors 4EBP1 and S6K2 are frequently coexpressed, and associated with a poor prognosis and endocrine resistance in breast cancer.
23393338 S6K2 amplification was frequently observed in gastric cancer and was related to a poor prognosis
22955948 The p85 S6K1 promotes H2O2-induced cell death via a rapamycin-insensitive mechanism.
21444676 S6K2 expression dictates tissue-specific requirement for S6K1 in mediating aberrant mTORC1 signaling and tumorigenesis
21427355 Study shows that the two homologues of S6K have distinct effects on Akt activation and cell survivalin breast cancer.
21035469 Data show that genetic variation in RPS6KA1, RPS6KA2, and PRS6KB2 were associated with risk of developing colon cancer while only genetic variation in RPS6KA2 was associated with altering risk of rectal cancer.
21035469 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAAVFDLDLETEEGSEGEGEPELSPADACPLAELRAAGLEPVGHYEEVELTETSVNVGPERIGPHCFELL      1 - 70
RVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVRNAKDTAHTRAERNILESVKHPFIVELAYAFQT     71 - 140
GGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITLALGHLHSQGIIYRDLKPENIMLSSQGHIKL    141 - 210
TDFGLCKESIHEGAVTHTFCGTIEYMAPEILVRSGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDK    211 - 280
IIRGKLALPPYLTPDARDLVKKFLKRNPSQRIGGGPGDAADVQRHPFFRHMNWDDLLAWRVDPPFRPCLQ    281 - 350
SEEDVSQFDTRFTRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRA    351 - 420
PVSPLKFSPFEGFRPSPSLPEPTELPLPPLLPPPPPSTTAPLPIRPPSGTKKSKRGRGRPGR            421 - 482
//

Text Mined References (41)

PMID Year Title
25124033 2014 Degradation of Tiam1 by casein kinase 1 and the SCF?TrCP ubiquitin ligase controls the duration of mTOR-S6K signaling.
24469061 2015 MicroRNA-193a-3p and -5p suppress the metastasis of human non-small-cell lung cancer by downregulating the ERBB4/PIK3R3/mTOR/S6K2 signaling pathway.
24131622 2013 The mTOR effectors 4EBP1 and S6K2 are frequently coexpressed, and associated with a poor prognosis and endocrine resistance in breast cancer: a retrospective study including patients from the randomised Stockholm tamoxifen trials.
23393338 2013 Gene amplification of ribosomal protein S6 kinase-1 and -2 in gastric cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22955948 2013 IKK-? mediates hydrogen peroxide induced cell death through p85 S6K1.
21444676 2011 Differential expression of S6K2 dictates tissue-specific requirement for S6K1 in mediating aberrant mTORC1 signaling and tumorigenesis.
21427355 2011 S6 kinase 2 promotes breast cancer cell survival via Akt.
21269460 2011 Initial characterization of the human central proteome.
21035469 2011 Genetic variation in RPS6KA1, RPS6KA2, RPS6KB1, RPS6KB2, and PDK1 and risk of colon or rectal cancer.
More...