Property Summary

NCBI Gene PubMed Count 15
Grant Count 173
R01 Count 89
Funding $47,700,800.91
PubMed Score 1076.90
PubTator Score 10.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
astrocytoma -4.800 0.000
ependymoma -5.500 0.000
oligodendroglioma -3.700 0.003
glioblastoma -6.300 0.000
osteosarcoma -1.415 0.019
medulloblastoma -6.400 0.000
atypical teratoid / rhabdoid tumor -6.600 0.000
medulloblastoma, large-cell -6.100 0.000
primitive neuroectodermal tumor -6.100 0.000
Amyotrophic Lateral Sclerosis 1.152 0.000
acute quadriplegic myopathy 1.821 0.000
juvenile dermatomyositis 1.609 0.000
lung cancer 1.200 0.001
pediatric high grade glioma -4.700 0.000
pilocytic astrocytoma -4.200 0.000
non primary Sjogren syndrome sicca -1.100 0.024
subependymal giant cell astrocytoma -3.019 0.037
Pick disease -1.300 0.022
progressive supranuclear palsy 1.200 0.014
pituitary cancer -2.600 0.001

Synonym

Accession Q9UBL0 B4DG96 Q49AK3 Q49AS6 Q4G0V4 Q6NYC3 Q86V31 Q9UF93 ARPP-21
Symbols RCS
TARPP
R3HDM3
ARPP-21

Gene

Gene RIF (2)

PMID Text
24127197 Interstitial deletion of 3p22.3p22.2 encompassing ARPP21 and CLASP2 is a potential pathogenic factor for a syndromic form of intellectual disability.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSEQGDLNQAIAEEGGTEQETATPENGIVKSESLDEEEKLELQRRLEAQNQERRKSKSGAGKGKLTRSLA      1 - 70
VCEESSARPGGESLQDQESIHLQLSSFSSLQEEDKSRKDDSEREKEKDKNKDKTSEKPKIRMLSKDCSQE     71 - 140
YTDSTGIDLHEFLINTLKNNSRDRMILLKMEQEIIDFIADNNNHYKKFPQMSSYQRMLVHRVAAYFGLDH    141 - 210
NVDQTGKSVIINKTSSTRIPEQRFCEHLKDEKGEESQKRFILKRDNSSIDKEDNQQNRMHPFRDDRRSKS    211 - 280
IEEREEEYQRVRERIFAHDSVCSQESLFVENSRLLEDSNICNETYKKRQLFRGNRDGSGRTSGSRQSSSE    281 - 350
NELKWSDHQRAWSSTDSDSSNRNLKPAMTKTASFGGITVLTRGDSTSSTRSTGKLSKAGSESSSSAGSSG    351 - 420
SLSRTHPPLQSTPLVSGVAAGSPGCVPYPENGIGGQVAPSSTSYILLPLEAATGIPPGSILLNPHTGQPF    421 - 490
VNPDGTPAIYNPPTSQQPLRSAMVGQSQQQPPQQQPSPQPQQQVQPPQPQMAGPLVTQRDDVATQFGQMT    491 - 560
LSRQSSGETPEPPSGPVYPSSLMPQPAQQPSYVIASTGQQLPTGGFSGSGPPISQQVLQPPPSPQGFVQQ    561 - 630
PPPAQMPVYYYPSGQYPTSTTQQYRPMAPVQYNAQRSQQMPQAAQQAGYQPVLSGQQGFQGLIGVQQPPQ    631 - 700
SQNVINNQQGTPVQSVMVSYPTMSSYQVPMTQGSQGLPQQSYQQPIMLPNQAGQGSLPATGMPVYCNVTP    701 - 770
PTPQNNLRLIGPHCPSSTVPVMSASCRTNCASMSNAGWQVKF                                771 - 812
//

Text Mined References (18)

PMID Year Title
24127197 2013 Interstitial deletion of 3p22.3p22.2 encompassing ARPP21 and CLASP2 is a potential pathogenic factor for a syndromic form of intellectual disability: a co-morbidity model with additional copy number variations in a large family.
21116278 2011 Genome-wide association with MRI atrophy measures as a quantitative trait locus for Alzheimer's disease.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19734545 2009 A genome-wide study of common SNPs and CNVs in cognitive performance in the CANTAB.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15499021 2004 A network of control mediated by regulator of calcium/calmodulin-dependent signaling.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...