Property Summary

NCBI Gene PubMed Count 15
PubMed Score 1158.70
PubTator Score 10.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
acute quadriplegic myopathy 1.821 4.4e-08
adult high grade glioma -2.800 4.2e-03
Amyotrophic lateral sclerosis 1.150 1.6e-06
astrocytic glioma -2.800 2.5e-03
Astrocytoma, Pilocytic -2.800 4.6e-05
atypical teratoid / rhabdoid tumor -3.200 1.1e-09
ependymoma -3.000 4.4e-03
glioblastoma -2.800 1.7e-08
group 3 medulloblastoma -2.800 3.0e-02
juvenile dermatomyositis 1.609 5.7e-13
lung cancer 1.200 1.4e-03
medulloblastoma, large-cell -3.100 1.2e-03
non primary Sjogren syndrome sicca -1.100 2.4e-02
oligodendroglioma -2.400 8.5e-03
osteosarcoma -1.415 1.9e-02
Pick disease -1.300 2.2e-02
pituitary cancer -2.600 9.6e-04
primitive neuroectodermal tumor -3.300 3.9e-05
progressive supranuclear palsy 1.200 1.4e-02
subependymal giant cell astrocytoma -1.596 4.4e-02

Gene RIF (2)

AA Sequence

MSEQGDLNQAIAEEGGTEQETATPENGIVKSESLDEEEKLELQRRLEAQNQERRKSKSGAGKGKLTRSLA      1 - 70
VCEESSARPGGESLQDQESIHLQLSSFSSLQEEDKSRKDDSEREKEKDKNKDKTSEKPKIRMLSKDCSQE     71 - 140
YTDSTGIDLHEFLINTLKNNSRDRMILLKMEQEIIDFIADNNNHYKKFPQMSSYQRMLVHRVAAYFGLDH    141 - 210
NVDQTGKSVIINKTSSTRIPEQRFCEHLKDEKGEESQKRFILKRDNSSIDKEDNQQNRMHPFRDDRRSKS    211 - 280
IEEREEEYQRVRERIFAHDSVCSQESLFVENSRLLEDSNICNETYKKRQLFRGNRDGSGRTSGSRQSSSE    281 - 350
NELKWSDHQRAWSSTDSDSSNRNLKPAMTKTASFGGITVLTRGDSTSSTRSTGKLSKAGSESSSSAGSSG    351 - 420
SLSRTHPPLQSTPLVSGVAAGSPGCVPYPENGIGGQVAPSSTSYILLPLEAATGIPPGSILLNPHTGQPF    421 - 490
VNPDGTPAIYNPPTSQQPLRSAMVGQSQQQPPQQQPSPQPQQQVQPPQPQMAGPLVTQRDDVATQFGQMT    491 - 560
LSRQSSGETPEPPSGPVYPSSLMPQPAQQPSYVIASTGQQLPTGGFSGSGPPISQQVLQPPPSPQGFVQQ    561 - 630
PPPAQMPVYYYPSGQYPTSTTQQYRPMAPVQYNAQRSQQMPQAAQQAGYQPVLSGQQGFQGLIGVQQPPQ    631 - 700
SQNVINNQQGTPVQSVMVSYPTMSSYQVPMTQGSQGLPQQSYQQPIMLPNQAGQGSLPATGMPVYCNVTP    701 - 770
PTPQNNLRLIGPHCPSSTVPVMSASCRTNCASMSNAGWQVKF                                771 - 812
//

Text Mined References (18)

PMID Year Title