Property Summary

NCBI Gene PubMed Count 15
PubMed Score 1076.90
PubTator Score 10.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 1.12088971903226E-14
juvenile dermatomyositis 1189 5.70184241484362E-13
medulloblastoma 1524 7.1475369123466E-11
glioblastoma 5572 6.17835474229638E-9
acute quadriplegic myopathy 1157 4.37290230773479E-8
astrocytoma 1493 1.51595627455662E-7
primitive neuroectodermal tumor 3031 2.21976351133056E-6
pediatric high grade glioma 2712 3.22760374419868E-6
Amyotrophic Lateral Sclerosis 432 5.100847393864E-6
pilocytic astrocytoma 3086 5.96335560030564E-6
medulloblastoma, large-cell 6234 2.18037628375504E-5
ependymoma 2514 4.98029373548395E-4
pituitary cancer 1972 9.57323508965249E-4
lung cancer 4473 0.00136079098690423
oligodendroglioma 2849 0.00294262694795681
progressive supranuclear palsy 674 0.0137522969205726
osteosarcoma 7933 0.0193246832138901
Pick disease 1893 0.021789820490443
non primary Sjogren syndrome sicca 840 0.0244925646146102
subependymal giant cell astrocytoma 2287 0.0373109242213868
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (20)

Disease log2 FC p
astrocytoma -4.800 0.000
ependymoma -5.500 0.000
oligodendroglioma -3.700 0.003
glioblastoma -6.300 0.000
osteosarcoma -1.415 0.019
medulloblastoma -6.400 0.000
atypical teratoid / rhabdoid tumor -6.600 0.000
medulloblastoma, large-cell -6.100 0.000
primitive neuroectodermal tumor -6.100 0.000
Amyotrophic Lateral Sclerosis 1.152 0.000
acute quadriplegic myopathy 1.821 0.000
juvenile dermatomyositis 1.609 0.000
lung cancer 1.200 0.001
pediatric high grade glioma -4.700 0.000
pilocytic astrocytoma -4.200 0.000
non primary Sjogren syndrome sicca -1.100 0.024
subependymal giant cell astrocytoma -3.019 0.037
Pick disease -1.300 0.022
progressive supranuclear palsy 1.200 0.014
pituitary cancer -2.600 0.001

Synonym

Accession Q9UBL0 B4DG96 Q49AK3 Q49AS6 Q4G0V4 Q6NYC3 Q86V31 Q9UF93 ARPP-21
Symbols RCS
TARPP
R3HDM3
ARPP-21

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
24127197 Interstitial deletion of 3p22.3p22.2 encompassing ARPP21 and CLASP2 is a potential pathogenic factor for a syndromic form of intellectual disability.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSEQGDLNQAIAEEGGTEQETATPENGIVKSESLDEEEKLELQRRLEAQNQERRKSKSGAGKGKLTRSLA      1 - 70
VCEESSARPGGESLQDQESIHLQLSSFSSLQEEDKSRKDDSEREKEKDKNKDKTSEKPKIRMLSKDCSQE     71 - 140
YTDSTGIDLHEFLINTLKNNSRDRMILLKMEQEIIDFIADNNNHYKKFPQMSSYQRMLVHRVAAYFGLDH    141 - 210
NVDQTGKSVIINKTSSTRIPEQRFCEHLKDEKGEESQKRFILKRDNSSIDKEDNQQNRMHPFRDDRRSKS    211 - 280
IEEREEEYQRVRERIFAHDSVCSQESLFVENSRLLEDSNICNETYKKRQLFRGNRDGSGRTSGSRQSSSE    281 - 350
NELKWSDHQRAWSSTDSDSSNRNLKPAMTKTASFGGITVLTRGDSTSSTRSTGKLSKAGSESSSSAGSSG    351 - 420
SLSRTHPPLQSTPLVSGVAAGSPGCVPYPENGIGGQVAPSSTSYILLPLEAATGIPPGSILLNPHTGQPF    421 - 490
VNPDGTPAIYNPPTSQQPLRSAMVGQSQQQPPQQQPSPQPQQQVQPPQPQMAGPLVTQRDDVATQFGQMT    491 - 560
LSRQSSGETPEPPSGPVYPSSLMPQPAQQPSYVIASTGQQLPTGGFSGSGPPISQQVLQPPPSPQGFVQQ    561 - 630
PPPAQMPVYYYPSGQYPTSTTQQYRPMAPVQYNAQRSQQMPQAAQQAGYQPVLSGQQGFQGLIGVQQPPQ    631 - 700
SQNVINNQQGTPVQSVMVSYPTMSSYQVPMTQGSQGLPQQSYQQPIMLPNQAGQGSLPATGMPVYCNVTP    701 - 770
PTPQNNLRLIGPHCPSSTVPVMSASCRTNCASMSNAGWQVKF                                771 - 812
//

Text Mined References (18)

PMID Year Title
24127197 2013 Interstitial deletion of 3p22.3p22.2 encompassing ARPP21 and CLASP2 is a potential pathogenic factor for a syndromic form of intellectual disability: a co-morbidity model with additional copy number variations in a large family.
21116278 2011 Genome-wide association with MRI atrophy measures as a quantitative trait locus for Alzheimer's disease.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19734545 2009 A genome-wide study of common SNPs and CNVs in cognitive performance in the CANTAB.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15499021 2004 A network of control mediated by regulator of calcium/calmodulin-dependent signaling.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...