Property Summary

NCBI Gene PubMed Count 8
PubMed Score 86.65
PubTator Score 17.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 1.200 1.3e-03
invasive ductal carcinoma 1.200 1.3e-02
lung cancer 1.600 1.8e-03
malignant mesothelioma -1.400 1.6e-06
Multiple myeloma 1.399 3.1e-03

AA Sequence

MELSESVQKGFQMLADPRSFDSNAFTLLLRAAFQSLLDAQADEAVLDHPDLKHIDPVVLKHCHAAAATYI      1 - 70
LEAGKHRADKSTLSTYLEDCKFDRERIELFCTEYQNNKNSLEILLGSIGRSLPHITDVSWRLEYQIKTNQ     71 - 140
LHRMYRPAYLVTLSVQNTDSPSYPEISFSCSMEQLQDLVGKLKDASKSLERATQL                   141 - 195
//

Text Mined References (12)

PMID Year Title